Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Synonym

Accession Q8NBZ9
Symbols C1orf118

Gene

 Compartment GO Term (0)

AA Sequence

MVWRFQKHIGKGSSQERPIRKDFLTGTAGRDGDRGWGKWWGTALNFPKDPKGSAEGSAPTPLTEGSLPTV      1 - 70
GNAPETQPTRRRGAGQRHCNQKPKAGRHFQTLGQPLVGTPPSPQDAAPRQGSPGPGPARTTAVWRPAPSG     71 - 140
AAAEHGQKPQTPSASLQPPFPPPPPPGDPTPPSPLPPAHVPPTLLTLQEPVTGEGTSFRVEGLCASRLAV    141 - 210
GRGLGALAANTSAPAAGSPLAAAAAAAAAVSSSKFP                                      211 - 246
//

Text Mined References (2)

PMID Year Title