Property Summary

NCBI Gene PubMed Count 21
PubMed Score 10.10
PubTator Score 3.38

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Gene RIF (8)

AA Sequence

MVSKALLRLVSAVNRRRMKLLLGIALLAYVASVWGNFVNMRSIQENGELKIESKIEEMVEPLREKIRDLE      1 - 70
KSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFEL     71 - 140
INHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPE    141 - 210
VHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQ    211 - 280
ALQGEPLTVYGSGSQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQF    281 - 350
LSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRHS    351 - 420
//

Text Mined References (25)

PMID Year Title