Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.09
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8NBZ0 Q6Y2K3
Symbols CCDC95

Gene

Gene RIF (1)

PMID Text
22082156 Knockdown of INO80 complex subunit E (INO80E) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N

AA Sequence

MNGPADGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLKVSRDKSFLLDRLLQYENVDEDSSDS      1 - 70
DATASSDNSETEGTPKLSDTPAPKRKRSPPLGGAPSPSSLSLPPSTGFPLQASGVPSPYLSSLASSRYPP     71 - 140
FPSDYLALQLPEPSPLRPKREKRPRLPRKLKMAVGPPDCPVGGPLTFPGRGSGAGVGTTLTPLPPPKMPP    141 - 210
PTILSTVPRQMFSDAGSGDDALDGDDDLVIDIPE                                        211 - 244
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
21303910 2011 Subunit organization of the human INO80 chromatin remodeling complex: an evolutionarily conserved core complex catalyzes ATP-dependent nucleosome remodeling.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
18922472 2008 Distinct modes of regulation of the Uch37 deubiquitinating enzyme in the proteasome and in the Ino80 chromatin-remodeling complex.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16230350 2005 A mammalian chromatin remodeling complex with similarities to the yeast INO80 complex.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...