Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.38
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

 IMPC Phenotype (1)

Gene RIF (1)

AA Sequence

MNGPADGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLKVSRDKSFLLDRLLQYENVDEDSSDS      1 - 70
DATASSDNSETEGTPKLSDTPAPKRKRSPPLGGAPSPSSLSLPPSTGFPLQASGVPSPYLSSLASSRYPP     71 - 140
FPSDYLALQLPEPSPLRPKREKRPRLPRKLKMAVGPPDCPVGGPLTFPGRGSGAGVGTTLTPLPPPKMPP    141 - 210
PTILSTVPRQMFSDAGSGDDALDGDDDLVIDIPE                                        211 - 244
//

Text Mined References (13)

PMID Year Title