Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 1.35692661167074E-8
ovarian cancer 8492 1.59925335816208E-5
interstitial cystitis 2299 3.69781486263138E-5
lung cancer 4473 3.78570145901609E-5
Atopic dermatitis 944 7.21116170553702E-5
osteosarcoma 7933 7.25381618299406E-5
adrenocortical carcinoma 1427 1.4817036413403E-4
psoriasis 6685 2.88501217826544E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00567803542446775
invasive ductal carcinoma 2950 0.00822174405439193
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0105361499321999
esophageal adenocarcinoma 737 0.0182449562946412
Disease Target Count Z-score Confidence
L-2-hydroxyglutaric aciduria 7 4.356 2.2
Mucoepidermoid carcinoma 19 3.648 1.8

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -3.300 0.000
esophageal adenocarcinoma 1.200 0.018
psoriasis -2.100 0.000
osteosarcoma -1.321 0.000
Atopic dermatitis -1.200 0.000
adrenocortical carcinoma -1.592 0.000
pancreatic ductal adenocarcinoma liver m... -1.414 0.006
intraductal papillary-mucinous neoplasm ... 1.500 0.011
lung cancer 1.700 0.000
interstitial cystitis -1.900 0.000
invasive ductal carcinoma 1.100 0.008
ovarian cancer 1.300 0.000

Synonym

Accession Q8NBX0 Q8TAR0 Q9Y363
Symbols NET11
CGI-49

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MATEQRPFHLVVFGASGFTGQFVTEEVAREQVDPERSSRLPWAVAGRSREKLQRVLEKAALKLGRPTLSS      1 - 70
EVGIIICDIANPASLDEMAKQATVVLNCVGPYRFYGEPVIKACIENGASCIDISGEPQFLELMQLKYHEK     71 - 140
AADKGVYIIGSSGFDSIPADLGVIYTRNKMNGTLTAVESFLTIHSGPEGLSIHDGTWKSAIYGFGDQSNL    141 - 210
RKLRNVSNLKPVPLIGPKLKRRWPISYCRELKGYSIPFMGSDVSVVRRTQRYLYENLEESPVQYAAYVTV    211 - 280
GGITSVIKLMFAGLFFLFFVRFGIGRQLLIKFPWFFSFGYFSKQGPTQKQIDAASFTLTFFGQGYSQGTG    281 - 350
TDKNKPNIKICTQVKGPEAGYVATPIAMVQAAMTLLSDASHLPKAGGVFTPGAAFSKTKLIDRLNKHGIE    351 - 420
FSVISSSEV                                                                 421 - 429
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
19946888 2010 Defining the membrane proteome of NK cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...