Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma -1.592 1.5e-04
Atopic dermatitis -1.200 7.2e-05
esophageal adenocarcinoma 1.200 1.8e-02
interstitial cystitis -1.100 7.2e-03
intraductal papillary-mucinous neoplasm ... 1.200 3.0e-02
invasive ductal carcinoma 1.100 8.2e-03
lung cancer 1.300 1.1e-02
malignant mesothelioma -3.000 3.2e-09
osteosarcoma -1.321 7.3e-05
ovarian cancer 1.300 1.6e-05
pancreatic ductal adenocarcinoma liver m... -1.414 5.7e-03
psoriasis -2.100 2.9e-04

 GO Function (1)

 GO Process (1)

Gene RIF (1)

AA Sequence

MATEQRPFHLVVFGASGFTGQFVTEEVAREQVDPERSSRLPWAVAGRSREKLQRVLEKAALKLGRPTLSS      1 - 70
EVGIIICDIANPASLDEMAKQATVVLNCVGPYRFYGEPVIKACIENGASCIDISGEPQFLELMQLKYHEK     71 - 140
AADKGVYIIGSSGFDSIPADLGVIYTRNKMNGTLTAVESFLTIHSGPEGLSIHDGTWKSAIYGFGDQSNL    141 - 210
RKLRNVSNLKPVPLIGPKLKRRWPISYCRELKGYSIPFMGSDVSVVRRTQRYLYENLEESPVQYAAYVTV    211 - 280
GGITSVIKLMFAGLFFLFFVRFGIGRQLLIKFPWFFSFGYFSKQGPTQKQIDAASFTLTFFGQGYSQGTG    281 - 350
TDKNKPNIKICTQVKGPEAGYVATPIAMVQAAMTLLSDASHLPKAGGVFTPGAAFSKTKLIDRLNKHGIE    351 - 420
FSVISSSEV                                                                 421 - 429
//

Text Mined References (18)

PMID Year Title