Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.59
PubTator Score 9.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
adrenocortical carcinoma 1.209 2.8e-04
adult high grade glioma 1.500 8.4e-04
atypical teratoid / rhabdoid tumor 1.200 4.1e-03
group 3 medulloblastoma 1.100 7.5e-03
intraductal papillary-mucinous adenoma (... 1.200 4.6e-03
medulloblastoma, large-cell 1.600 2.3e-05
ovarian cancer -1.300 5.8e-03
Pick disease 1.100 1.0e-04

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MANMNSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSKRPFCIEPTNIVNVNHVIQRVSDHASAMNKRIHY      1 - 70
YSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLQSYTEGYGKNTSLVTIFMIWNTMMGTSILSIPW     71 - 140
GIKQAGFTTGMCVIILMGLLTLYCCYRVVKSRTMMFSLDTTSWEYPDVCRHYFGSFGQWSSLLFSLVSLI    141 - 210
GAMIVYWVLMSNFLFNTGKFIFNFIHHINDTDTILSTNNSNPVICPSAGSGGHPDNSSMIFYANDTGAQQ    211 - 280
FEKWWDKSRTVPFYLVGLLLPLLNFKSPSFFSKFNILGTVSVLYLIFLVTFKAVRLGFHLEFHWFIPTEF    281 - 350
FVPEIRFQFPQLTGVLTLAFFIHNCIITLLKNNKKQENNVRDLCIAYMLVTLTYLYIGVLVFASFPSPPL    351 - 420
SKDCIEQNFLDNFPSSDTLSFIARIFLLFQMMTVYPLLGYLARVQLLGHIFGDIYPSIFHVLILNLIIVG    421 - 490
AGVIMACFYPNIGGIIRYSGAACGLAFVFIYPSLIYIISLHQEERLTWPKLIFHVFIIILGVANLIVQFF    491 - 560
M//

Text Mined References (17)

PMID Year Title