Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.76
PubTator Score 9.15

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8NBW4 A0A0A8K8P2 B3KXV1 B7Z7D0 Q0P5S0 Q6MZJ8
Symbols URLC11

Gene

PANTHER Protein Class (2)

Gene RIF (4)

PMID Text
25963655 Data suggest that amino acid transporter SLC38A9 controls mTORC1 activity through binding to the Rag-Ragulator complex at the lysosome upon amino acid availability.
25567906 SLC38A9 functions upstream of the Rag GTPases and is an excellent candidate for being an arginine sensor for the mTORC1 pathway.
25561175 SLC38A9 is a physical and functional component of the amino acid sensing machinery that controls the activation of mTOR
24762746 SNPs within SLC38A9 are correlated with inflammatory bowel disease patients' 6-thioguanine nucleotide blood concentrations.

AA Sequence

MANMNSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSKRPFCIEPTNIVNVNHVIQRVSDHASAMNKRIHY      1 - 70
YSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLQSYTEGYGKNTSLVTIFMIWNTMMGTSILSIPW     71 - 140
GIKQAGFTTGMCVIILMGLLTLYCCYRVVKSRTMMFSLDTTSWEYPDVCRHYFGSFGQWSSLLFSLVSLI    141 - 210
GAMIVYWVLMSNFLFNTGKFIFNFIHHINDTDTILSTNNSNPVICPSAGSGGHPDNSSMIFYANDTGAQQ    211 - 280
FEKWWDKSRTVPFYLVGLLLPLLNFKSPSFFSKFNILGTVSVLYLIFLVTFKAVRLGFHLEFHWFIPTEF    281 - 350
FVPEIRFQFPQLTGVLTLAFFIHNCIITLLKNNKKQENNVRDLCIAYMLVTLTYLYIGVLVFASFPSPPL    351 - 420
SKDCIEQNFLDNFPSSDTLSFIARIFLLFQMMTVYPLLGYLARVQLLGHIFGDIYPSIFHVLILNLIIVG    421 - 490
AGVIMACFYPNIGGIIRYSGAACGLAFVFIYPSLIYIISLHQEERLTWPKLIFHVFIIILGVANLIVQFF    491 - 560
M//

Text Mined References (15)

PMID Year Title
25963655 2015 Amino Acid-Dependent mTORC1 Regulation by the Lysosomal Membrane Protein SLC38A9.
25567906 2015 Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1.
25561175 2015 SLC38A9 is a component of the lysosomal amino acid sensing machinery that controls mTORC1.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
24762746 2014 New genetic biomarkers predicting azathioprine blood concentrations in combination therapy with 5-aminosalicylic acid.
23506890 Evolutionary origin of amino acid transporter families SLC32, SLC36 and SLC38 and physiological, pathological and therapeutic aspects.
23462296 2013 Microarray-based detection and expression analysis of ABC and SLC transporters in drug-resistant ovarian cancer cell lines.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...