Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.64
PubTator Score 3.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.99827105172476E-73
interstitial cystitis 2299 4.84758556611772E-5
inflammatory breast cancer 404 9.36604483198009E-4
pancreatic cancer 2300 0.00134228750262963
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0300963496233848

Expression

  Differential Expression (5)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... 2.106 0.030
pancreatic cancer 1.100 0.001
interstitial cystitis -2.500 0.000
psoriasis -3.200 0.000
inflammatory breast cancer -1.700 0.001

Synonym

Accession Q8NBV8 A6NFJ4 Q9NSV9
Symbols

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG

Gene RIF (4)

PMID Text
21336277 Inactivation of the insulin promoter by promoter-targeting siRNA reduces SYT8 gene expression.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLHLHGWQTMQGRKMGHPPVSPSAPAPAGTTAIPGLIPDLVAGTPWPRWALIAGALAAGVLLVSCLLCAA      1 - 70
CCCCRRHRKKPRDKESVGLGSARGTTTTHLVQPDVDGLESSPGDAQQWGCLQLSLEFDFGSQEIRVGLRQ     71 - 140
AADLRPGGTVDPYARVSVSTQAGHRHETKVHRGTLCPVFDETCCFHIPQAELPGATLQVQLFNFKRFSGH    141 - 210
EPLGELRLPLGTVDLQHVLEHWYLLGPPAATQPEQVGELCFSLRYVPSSGRLTVVVLEARGLRPGLAEPY    211 - 280
VKVQLMLNQRKWKKRKTATKKGTAAPYFNEAFTFLVPFSQVQNVDLVLAVWDRSLPLRTEPVGKVHLGAR    281 - 350
ASGQPLQHWADMLAHARRPIAQRHPLRPAREVDRMLALQPRLRLRLPLPHS                       351 - 401
//

Text Mined References (12)

PMID Year Title
24065953 2013 The functional significance of synaptotagmin diversity in neuroendocrine secretion.
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
22928559 2012 Chromatin structure, epigenetic mechanisms and long-range interactions in the human insulin locus.
21336277 2011 Mapping of INS promoter interactions reveals its role in long-range regulation of SYT8 transcription.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...