Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.66
PubTator Score 2.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy -1.013 1.4e-04
atypical teratoid / rhabdoid tumor -1.500 1.9e-05
breast carcinoma -1.500 1.0e-04
fibroadenoma -1.400 2.9e-02
glioblastoma -1.100 2.1e-03
group 4 medulloblastoma -1.100 6.6e-06
invasive ductal carcinoma -1.400 2.3e-03
medulloblastoma, large-cell -1.400 1.6e-04
osteosarcoma 1.347 2.2e-04
primitive neuroectodermal tumor -1.200 2.1e-03
psoriasis -1.200 4.3e-38

Gene RIF (1)

AA Sequence

MPASQSRARARDRNNVLNRAEFLSLNQPPKGGPEPRSSGRKASGPSAQPPPAGDGARERRQSQQLPEEDC      1 - 70
MQLNPSFKGIAFNSLLAIDICMSKRLGVCAGRAASWASARSMVKLIGITGHGIPWIGGTILCLVKSSTLA     71 - 140
GQEVLMNLLLALLLDIMTVAGVQKLIKRRGPYETSPSLLDYLTMDIYAFPAGHASRAAMVSKFFLSHLVL    141 - 210
AVPLRVLLVLWALCVGLSRVMIGRHHVTDVLSGFVIGYLQFRLVELVWMPSSTCQMLISAW             211 - 271
//

Text Mined References (7)

PMID Year Title