Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.66
PubTator Score 2.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma 1.347 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.100 0.002
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.400 0.000
primitive neuroectodermal tumor -1.200 0.002
acute quadriplegic myopathy -1.013 0.000
breast carcinoma -1.500 0.000
fibroadenoma -1.400 0.029
invasive ductal carcinoma -1.400 0.002
psoriasis -1.200 0.000

Synonym

Accession Q8NBV4 Q5T6P0 Q96SS7 Q9BRC3
Symbols NET39
C9orf67
PPAPDC3

Gene

PANTHER Protein Class (2)

Gene RIF (1)

PMID Text
19704009 NET39 is a muscle-enriched nuclear envelope transmembrane protein, which regulates initiation of myogenic differentiation via affecting mTOR-IGF-II pathway.

AA Sequence

MPASQSRARARDRNNVLNRAEFLSLNQPPKGGPEPRSSGRKASGPSAQPPPAGDGARERRQSQQLPEEDC      1 - 70
MQLNPSFKGIAFNSLLAIDICMSKRLGVCAGRAASWASARSMVKLIGITGHGIPWIGGTILCLVKSSTLA     71 - 140
GQEVLMNLLLALLLDIMTVAGVQKLIKRRGPYETSPSLLDYLTMDIYAFPAGHASRAAMVSKFFLSHLVL    141 - 210
AVPLRVLLVLWALCVGLSRVMIGRHHVTDVLSGFVIGYLQFRLVELVWMPSSTCQMLISAW             211 - 271
//

Text Mined References (7)

PMID Year Title
19704009 2009 Regulation of myoblast differentiation by the nuclear envelope protein NET39.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12958361 2003 Nuclear membrane proteins with potential disease links found by subtractive proteomics.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.