Property Summary

NCBI Gene PubMed Count 12
PubMed Score 9.08
PubTator Score 1.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Protein-protein Interaction (1)

Gene RIF (3)

AA Sequence

MVHAEAFSRPLSRNEVVGLIFRLTIFGAVTYFTIKWMVDAIDPTRKQKVEAQKQAEKLMKQIGVKNVKLS      1 - 70
EYEMSIAAHLVDPLNMHVTWSDIAGLDDVITDLKDTVILPIKKKHLFENSRLLQPPKGVLLYGPPGCGKT     71 - 140
LIAKATAKEAGCRFINLQPSTLTDKWYGESQKLAAAVFSLAIKLQPSIIFIDEIDSFLRNRSSSDHEATA    141 - 210
MMKAQFMSLWDGLDTDHSCQVIVMGATNRPQDLDSAIMRRMPTRFHINQPALKQREAILKLILKNENVDR    211 - 280
HVDLLEVAQETDGFSGSDLKEMCRDAALLCVREYVNSTSEESHDEDEIRPVQQQDLHRAIEKMKKSKDAA    281 - 350
FQNVLTHVCLD                                                               351 - 361
//

Text Mined References (20)

PMID Year Title