Property Summary

NCBI Gene PubMed Count 13
PubMed Score 15.78
PubTator Score 4.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer 1.300 1.4e-11
group 3 medulloblastoma 1.400 1.5e-04
medulloblastoma, large-cell 1.100 3.4e-03
osteosarcoma -1.953 5.4e-04
ovarian cancer 1.600 4.7e-05
primitive neuroectodermal tumor 1.100 7.0e-03
psoriasis 1.100 9.8e-43

Protein-protein Interaction (8)

Gene RIF (4)

AA Sequence

MAAFRDIEEVSQGLLSLLGANRAEAQQRRLLGRHEQVVERLLETQDGAEKQLREILTMEKEVAQSLLNAK      1 - 70
EQVHQGGVELQQLEAGLQEAGEEDTRLKASLLYLTRELEELKEIEADLERQEKEVDEDTTVTIPSAVYVA     71 - 140
QLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLVDTEW                 141 - 197
//

Text Mined References (20)

PMID Year Title