Property Summary

NCBI Gene PubMed Count 12
Grant Count 7
Funding $173,514.6
PubMed Score 12.62
PubTator Score 4.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.953 0.001
medulloblastoma, large-cell 1.100 0.003
primitive neuroectodermal tumor 1.100 0.007
group 3 medulloblastoma 1.400 0.000
Breast cancer 1.900 0.000
ovarian cancer 1.600 0.000
psoriasis 1.100 0.000

Gene RIF (3)

PMID Text
26515591 Data indicate that kinetochore protein Spc24 (SPC24) may be a promising molecular target for hepatocellular carcinoma (HCC) therapy.
15961401 the Spc24, Spc25, Nuf2, and Ndc80/Hec1 complex is a faithful copy of the endogenous Ndc80 complex
14699129 hSPC24 is a component of the human NDC80 kinetochore complex

AA Sequence

MAAFRDIEEVSQGLLSLLGANRAEAQQRRLLGRHEQVVERLLETQDGAEKQLREILTMEKEVAQSLLNAK      1 - 70
EQVHQGGVELQQLEAGLQEAGEEDTRLKASLLYLTRELEELKEIEADLERQEKEVDEDTTVTIPSAVYVA     71 - 140
QLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLVDTEW                 141 - 197
//

Text Mined References (19)

PMID Year Title
26515591 2015 A novel prognostic biomarker SPC24 up-regulated in hepatocellular carcinoma.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24386095 2013 A genome wide association study identifies common variants associated with lipid levels in the Chinese population.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23085020 2012 The kinetochore-bound Ska1 complex tracks depolymerizing microtubules and binds to curved protofilaments.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
More...