Property Summary

NCBI Gene PubMed Count 12
PubMed Score 12.62
PubTator Score 4.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 9.83497058264837E-43
Breast cancer 3099 7.21338213566243E-8
ovarian cancer 8492 4.66645275472853E-5
group 3 medulloblastoma 2254 1.48110732303224E-4
osteosarcoma 7933 5.42750990108947E-4
medulloblastoma, large-cell 6234 0.00337241669636185
primitive neuroectodermal tumor 3031 0.00697362058115323

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.953 0.001
medulloblastoma, large-cell 1.100 0.003
primitive neuroectodermal tumor 1.100 0.007
group 3 medulloblastoma 1.400 0.000
Breast cancer 1.900 0.000
ovarian cancer 1.600 0.000
psoriasis 1.100 0.000

Synonym

Accession Q8NBT2 B4DZZ7 C9JGC4 hSpc24
Symbols SPBC24

Gene

PDB

2VE7   3IZ0  

  Ortholog (11)

 GWAS Trait (1)

Gene RIF (3)

PMID Text
26515591 Data indicate that kinetochore protein Spc24 (SPC24) may be a promising molecular target for hepatocellular carcinoma (HCC) therapy.
15961401 the Spc24, Spc25, Nuf2, and Ndc80/Hec1 complex is a faithful copy of the endogenous Ndc80 complex
14699129 hSPC24 is a component of the human NDC80 kinetochore complex

AA Sequence

MAAFRDIEEVSQGLLSLLGANRAEAQQRRLLGRHEQVVERLLETQDGAEKQLREILTMEKEVAQSLLNAK      1 - 70
EQVHQGGVELQQLEAGLQEAGEEDTRLKASLLYLTRELEELKEIEADLERQEKEVDEDTTVTIPSAVYVA     71 - 140
QLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLVDTEW                 141 - 197
//

Text Mined References (19)

PMID Year Title
26515591 2015 A novel prognostic biomarker SPC24 up-regulated in hepatocellular carcinoma.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24386095 2013 A genome wide association study identifies common variants associated with lipid levels in the Chinese population.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23085020 2012 The kinetochore-bound Ska1 complex tracks depolymerizing microtubules and binds to curved protofilaments.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
More...