Property Summary

NCBI Gene PubMed Count 17
PubMed Score 18.45
PubTator Score 44.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
psoriasis 6694 1.3e-58
Breast cancer 3578 1.6e-15
ovarian cancer 8520 7.5e-12
lung adenocarcinoma 2716 3.1e-09
osteosarcoma 7950 4.6e-03
Disease Target Count Z-score Confidence
Hypotrichosis 47 3.597 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 1.200 1.6e-15
lung adenocarcinoma 1.500 3.1e-09
osteosarcoma -1.151 4.6e-03
ovarian cancer 1.600 7.5e-12
psoriasis 1.200 1.3e-58

Protein-protein Interaction (13)

Gene RIF (7)

AA Sequence

MAAPCAEDPSLERHFKGHRDAVTCVDFSINTKQLASGSMDSCLMVWHMKPQSRAYRFTGHKDAVTCVNFS      1 - 70
PSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDGQSFVTASDDKTVKVWATHRQKFLFS     71 - 140
LSQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKSSRECVHSYCEHGGFVTYVDFHPSGTCIAAAGMDNT    141 - 210
VKVWDVRTHRLLQHYQLHSAAVNGLSFHPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFS    211 - 280
RTGEYFASGGSDEQVMVWKSNFDIVDHGEVTKVPRPPATLASSMGNLPEVDFPVPPGRGRSVESVQSQPQ    281 - 350
EPVSVPQTLTSTLEHIVGQLDVLTQTVSILEQRLTLTEDKLKQCLENQQLIMQRATP                 351 - 407
//

Text Mined References (19)

PMID Year Title