Property Summary

NCBI Gene PubMed Count 35
Grant Count 7
R01 Count 5
Funding $228,915.58
PubMed Score 27.33
PubTator Score 35.75

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession Q8NBS9 B2RDM2 Q5TCQ0 Q8ND33 Q8TCT2 Q9BVH9
Symbols HCC2
ERP46
HCC-2
STRF8
PDIA15
UNQ364
ENDOPDI

Gene

PDB

2DIZ   3UJ1   3UVT   3WGD   3WGE   3WGX  

Gene RIF (24)

PMID Text
25500540 we defined an important role of TXNDC5 in CRPC and further investigations are needed to screen TXNDC5 antagonists as a novel therapeutic approaches to treat PCa patients with Castration-resistant prostate cancer.
24594673 suggest that the tumorigenic properties of ERp46 in RCC cells are not related to an inhibitory modulation of AdipoR1
24462249 Role of ERp46 in oxidative protein folding.Independent actions of ERp46 thioredoxin domains on folding substrates.Structure of thioredoxin ERp46 domains.
24103565 Endo-PDI is a novel, important mediator of AP-1-driven gene expression and endothelial angiogenic function.
24100949 TXNDC5 has increased expression in many tumors that is involved in the proliferation and migration of tumor cells, acting as a tumor-enhancing gene.
24023338 results suggest that TXNDC5 polymorphisms could be related to the development of HCC in the Korean male population
23713588 Hyperoxidized peroxiredoxin 2 interacts with the protein disulfide- isomerase ERp46.
23376096 Authors show that ERp46 is able to bind to a large pool of peptides containing aromatic and basic residues via all three of its catalytic domains (a(0), a and a'), though the a(0) domain may contain the primary binding site.
23326410 Hypoxia induced TXCNDC5 expression, which contributed to adiponectin expression, cytokine production and the cellular proliferation and migration of fibroblasts in rheumatoid arthritis.
22505402 crystal structure of the third catalytic domain of protein disulfide isomerase ERp46 (also known as protein disulfide isomerase A5 and TXNDC5) was determined to 2.0 A resolution
More...

AA Sequence

MPARPGRLLPLLARPAALTALLLLLLGHGGGGRWGARAQEAAAAAADGPPAADGEDGQDPHSKHLYTADM      1 - 70
FTHGIQSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTAHSDVCSAQGVRGYPTLK     71 - 140
LFKPGQEAVKYQGPRDFQTLENWMLQTLNEEPVTPEPEVEPPSAPELKQGLYELSASNFELHVAQGDHFI    141 - 210
KFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGK    211 - 280
RDLESLREYVESQLQRTETGATETVTPSEAPVLAAEPEADKGTVLALTENNFDDTIAEGITFIKFYAPWC    281 - 350
GHCKTLAPTWEELSKKEFPGLAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSL    351 - 420
HRFVLSQAKDEL                                                              421 - 432
//

Text Mined References (39)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25500540 2015 The role of TXNDC5 in castration-resistant prostate cancer-involvement of androgen receptor signaling pathway.
24594673 2014 Endoplasmic reticulum protein ERp46 in renal cell carcinoma.
24462249 2014 Radically different thioredoxin domain arrangement of ERp46, an efficient disulfide bond introducer of the mammalian PDI family.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24103565 2013 Endo-PDI is required for TNF?-induced angiogenesis.
24100949 2013 Investigating a pathogenic role for TXNDC5 in tumors.
24023338 2013 TXNDC5 gene polymorphism contributes to increased risk of hepatocellular carcinoma in the Korean male population.
23713588 2013 Hyperoxidized peroxiredoxin 2 interacts with the protein disulfide- isomerase ERp46.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
More...