Property Summary

NCBI Gene PubMed Count 38
PubMed Score 32.60
PubTator Score 35.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

Synonym

Accession Q8NBS9 B2RDM2 Q5TCQ0 Q8ND33 Q8TCT2 Q9BVH9
Symbols HCC2
ERP46
HCC-2
STRF8
PDIA15
UNQ364
ENDOPDI

Gene

PDB

2DIZ   3UJ1   3UVT   3WGD   3WGE   3WGX  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (5)

Gene RIF (26)

AA Sequence

MPARPGRLLPLLARPAALTALLLLLLGHGGGGRWGARAQEAAAAAADGPPAADGEDGQDPHSKHLYTADM      1 - 70
FTHGIQSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTAHSDVCSAQGVRGYPTLK     71 - 140
LFKPGQEAVKYQGPRDFQTLENWMLQTLNEEPVTPEPEVEPPSAPELKQGLYELSASNFELHVAQGDHFI    141 - 210
KFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGK    211 - 280
RDLESLREYVESQLQRTETGATETVTPSEAPVLAAEPEADKGTVLALTENNFDDTIAEGITFIKFYAPWC    281 - 350
GHCKTLAPTWEELSKKEFPGLAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSL    351 - 420
HRFVLSQAKDEL                                                              421 - 432
//

Text Mined References (42)

PMID Year Title