Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.80
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession Q8NBR9
Symbols

Gene

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
23964515 Our data confirm the possibility of gain of new protein-coding genes during human evolution due to simple accumulation of point mutations

AA Sequence

MTQLPELGLRSPNNKSPTGPHPLEHLLARLLKRRRRSTLMSSPRSLLCSISGPGSHLLSTHPILCHSVYQ      1 - 70
PPQPASRPQAKRYQGLLPVPLAPHPLCLSGQLYLPNIPCTVIDGCGPVISHLKLTMYPWGLPPSHLGSSS     71 - 140
PFSANMEQWDYYKSQTRFAPFLPESFCGSPLPSEQSSRPFGLAFKVLCAATCQPPQFQLLWLCPYKLDLH    141 - 210
QRICLPPNLALVLLGALWTSPPPGSFLQPPYNRPYKLYKTN                                 211 - 251
//

Text Mined References (6)

PMID Year Title
23964515 [Experimental analysis of human specific protein coding open reading frame c11orf72].
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.