Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.80
PubTator Score 1.00

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 5.41526412679249E-10
diabetes mellitus 1663 0.00104821351867176
Disease Target Count Z-score Confidence
Testicular cancer 24 3.55 1.8


Accession Q8NBR9


 Compartment GO Term (1)

Gene RIF (1)

23964515 Our data confirm the possibility of gain of new protein-coding genes during human evolution due to simple accumulation of point mutations

AA Sequence

QRICLPPNLALVLLGALWTSPPPGSFLQPPYNRPYKLYKTN                                 211 - 251

Text Mined References (6)

PMID Year Title
23964515 [Experimental analysis of human specific protein coding open reading frame c11orf72].
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.