Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.80
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 5.4e-10
diabetes mellitus 1728 1.0e-03
Disease Target Count Z-score Confidence
Testicular cancer 25 3.571 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.500 1.0e-03
osteosarcoma 2.912 5.4e-10

Synonym

Accession Q8NBR9
Symbols

Gene

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MTQLPELGLRSPNNKSPTGPHPLEHLLARLLKRRRRSTLMSSPRSLLCSISGPGSHLLSTHPILCHSVYQ      1 - 70
PPQPASRPQAKRYQGLLPVPLAPHPLCLSGQLYLPNIPCTVIDGCGPVISHLKLTMYPWGLPPSHLGSSS     71 - 140
PFSANMEQWDYYKSQTRFAPFLPESFCGSPLPSEQSSRPFGLAFKVLCAATCQPPQFQLLWLCPYKLDLH    141 - 210
QRICLPPNLALVLLGALWTSPPPGSFLQPPYNRPYKLYKTN                                 211 - 251
//

Text Mined References (6)

PMID Year Title