Property Summary

NCBI Gene PubMed Count 34
Grant Count 6
R01 Count 6
Funding $278,955
PubMed Score 33.26
PubTator Score 16.86

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
26719361 Identify rs2276415 as a candidate genetic factor predisposing patients with type 2 diabetes to chronic kidney disease.
24845055 hAQP11 permeates both water and glycerol, localizing in the vicinity of lipid droplets in human adipocytes.
23359558 Built accurate 3D-models for AQP11 and AQP12 and comprehensively compared their sequence and structure to other known aquaporins.
21118806 the corresponding NPC motif of AQP11 is essential for full expression of molecular function.

AA Sequence

MSPLLGLRSELQDTCTSLGLMLSVVLLMGLARVVARQQLHRPVAHAFVLEFLATFQLCCCTHELQLLSEQ      1 - 70
HPAHPTWTLTLVYFFSLVHGLTLVGTSSNPCGVMMQMMLGGMSPETGAVRLLAQLVSALCSRYCTSALWS     71 - 140
LGLTQYHVSERSFACKNPIRVDLLKAVITEAVCSFLFHSALLHFQEVRTKLRIHLLAALITFLVYAGGSL    141 - 210
TGAVFNPALALSLHFMCFDEAFPQFFIVYWLAPSLGILLMILMFSFFLPWLHNNHTINKKE             211 - 271
//

Text Mined References (34)

PMID Year Title
26719361 2016 Aquaporin 11 variant associates with kidney disease in type 2 diabetic patients.
24845055 2014 Human aquaporin-11 is a water and glycerol channel and localizes in the vicinity of lipid droplets in human adipocytes.
23643386 2013 Weight loss after gastric bypass is associated with a variant at 15q26.1.
23359558 2013 In silico study of human aquaporin AQP11 and AQP12 channels.
21251984 2011 Water permeability and characterization of aquaporin-11.
21118806 2011 The NPC motif of aquaporin-11, unlike the NPA motif of known aquaporins, is essential for full expression of molecular function.
18762715 2008 Functional characterization of human aquaporin 9 as a facilitative glycerol carrier.
18511455 2008 Novel variants in human Aquaporin-4 reduce cellular water permeability.
18501347 2008 Functional characterization of a human aquaporin 0 mutation that leads to a congenital dominant lens cataract.
18202181 2008 Mechanism of selectivity in aquaporins and aquaglyceroporins.
More...