Property Summary

NCBI Gene PubMed Count 35
PubMed Score 36.47
PubTator Score 16.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

 IMPC Phenotype (1)

Gene RIF (5)

AA Sequence

MSPLLGLRSELQDTCTSLGLMLSVVLLMGLARVVARQQLHRPVAHAFVLEFLATFQLCCCTHELQLLSEQ      1 - 70
HPAHPTWTLTLVYFFSLVHGLTLVGTSSNPCGVMMQMMLGGMSPETGAVRLLAQLVSALCSRYCTSALWS     71 - 140
LGLTQYHVSERSFACKNPIRVDLLKAVITEAVCSFLFHSALLHFQEVRTKLRIHLLAALITFLVYAGGSL    141 - 210
TGAVFNPALALSLHFMCFDEAFPQFFIVYWLAPSLGILLMILMFSFFLPWLHNNHTINKKE             211 - 271
//

Text Mined References (35)

PMID Year Title