Property Summary

NCBI Gene PubMed Count 19
PubMed Score 10.97
PubTator Score 9.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 7.1e-04
Barrett's esophagus 2.100 3.1e-02
breast carcinoma -1.500 1.3e-04
cystic fibrosis 1.182 3.9e-05
dermatomyositis 1.100 2.2e-03
Duchenne muscular dystrophy 1.360 1.4e-06
esophageal adenocarcinoma 2.600 1.8e-02
fibroadenoma -1.200 2.7e-02
glioblastoma 1.400 1.3e-02
lung adenocarcinoma -1.600 4.2e-09
lung cancer -1.100 2.2e-02
lung carcinoma -2.200 3.5e-23
malignant mesothelioma -2.100 3.0e-07
Multiple myeloma 1.370 2.4e-03
non-small cell lung cancer -1.350 9.0e-19
ovarian cancer -3.000 4.4e-11
primary Sjogren syndrome 1.300 7.2e-03
sonic hedgehog group medulloblastoma 1.600 7.3e-06
ulcerative colitis -1.500 5.7e-09
Waldenstrons macroglobulinemia 1.668 4.2e-03

Gene RIF (5)

AA Sequence

MKFLLDILLLLPLLIVCSLESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINK      1 - 70
HGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKT     71 - 140
FEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITG    141 - 210
VKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAV    211 - 280
LKQKISVKFDAVIGYKMKAQ                                                      281 - 300
//

Text Mined References (22)

PMID Year Title