Property Summary

NCBI Gene PubMed Count 19
PubMed Score 10.84
PubTator Score 9.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.668 0.004
Multiple myeloma 1.370 0.002
malignant mesothelioma -2.100 0.000
Barrett's esophagus 2.100 0.031
esophageal adenocarcinoma 2.600 0.018
cystic fibrosis 1.182 0.000
glioblastoma 1.400 0.013
atypical teratoid/rhabdoid tumor 1.400 0.000
Duchenne muscular dystrophy 1.360 0.000
non-small cell lung cancer -1.350 0.000
lung cancer -1.600 0.000
breast carcinoma -1.500 0.000
fibroadenoma -1.200 0.027
sonic hedgehog group medulloblastoma 1.600 0.000
primary Sjogren syndrome 1.300 0.007
lung adenocarcinoma -1.600 0.000
lung carcinoma -2.200 0.000
ulcerative colitis -1.500 0.000
ovarian cancer -3.000 0.000
dermatomyositis 1.100 0.002

Synonym

Accession Q8NBQ5 Q96HF6 Q9UKU4
Symbols DHRS8
PAN1B
RETSDR2
SDR16C2
17BHSD11
17-BETA-HSD11
17-BETA-HSDXI

Gene

PANTHER Protein Class (2)

PDB

1YB1  

Gene RIF (5)

PMID Text
26472732 knowledge of its in vitro activity together with a newly described expression pattern at the protein level in tissues involved in steroidogenesis and detoxification could suggest a potential role of DHRS8 in vivo
21549806 hydroxysteroid (17-beta) dehydrogenase 11 transcription in prostate cancer cells is regulated by Sp1 transcription factor and C-EBP alpha
19469652 Increased Pan1b is associated with prostate cancer of seminal vesicle invasion.
18804447 Mutation analyses suggest that the PAT-like motif in 17betaHSD11 will not be functionally similar to the canonical PAT motif.
12697717 Role for 17-beta-HSDXI in androgen metabolism during steroidogenesis.

AA Sequence

MKFLLDILLLLPLLIVCSLESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINK      1 - 70
HGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKT     71 - 140
FEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITG    141 - 210
VKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAV    211 - 280
LKQKISVKFDAVIGYKMKAQ                                                      281 - 300
//

Text Mined References (22)

PMID Year Title
26472732 2016 Human dehydrogenase/reductase (SDR family) member 8 (DHRS8): a description and evaluation of its biochemical properties.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23568457 2013 Genetic variants associated with disordered eating.
21549806 2011 Transcriptional regulation of type 11 17?-hydroxysteroid dehydrogenase expression in prostate cancer cells.
21269460 2011 Initial characterization of the human central proteome.
19469652 2009 17beta-hydroxysteroid dehydrogenase type 11 (Pan1b) expression in human prostate cancer.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
18804447 2008 Identification and characterization of the ER/lipid droplet-targeting sequence in 17beta-hydroxysteroid dehydrogenase type 11.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
More...