Property Summary

NCBI Gene PubMed Count 19
PubMed Score 10.84
PubTator Score 9.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 3.48507140028399E-23
non-small cell lung cancer 2798 8.95503895651932E-19
ovarian cancer 8492 4.44277485715338E-11
lung adenocarcinoma 2714 4.23843043336573E-9
ulcerative colitis 2087 5.7446234840635E-9
malignant mesothelioma 3163 2.95152283216683E-7
Duchenne muscular dystrophy 602 1.41357431301104E-6
sonic hedgehog group medulloblastoma 1482 7.29153721151855E-6
atypical teratoid/rhabdoid tumor 1095 1.34484552286185E-5
cystic fibrosis 1670 3.86047446644266E-5
lung cancer 4473 4.15070463075756E-5
breast carcinoma 1614 1.28735517603864E-4
dermatomyositis 967 0.00216427955270865
Multiple myeloma 1328 0.00241461124753884
Waldenstrons macroglobulinemia 765 0.00421400354467135
primary Sjogren syndrome 789 0.00717893497389468
glioblastoma 5572 0.0134552374835929
esophageal adenocarcinoma 737 0.0176010007179145
fibroadenoma 557 0.0274557694319554
Barrett's esophagus 185 0.0308662509436781
Disease Target Count Z-score Confidence
Adrenal carcinoma 4 3.957 2.0

Expression

  Differential Expression (20)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.668 0.004
Multiple myeloma 1.370 0.002
malignant mesothelioma -2.100 0.000
Barrett's esophagus 2.100 0.031
esophageal adenocarcinoma 2.600 0.018
cystic fibrosis 1.182 0.000
glioblastoma 1.400 0.013
atypical teratoid/rhabdoid tumor 1.400 0.000
Duchenne muscular dystrophy 1.360 0.000
non-small cell lung cancer -1.350 0.000
lung cancer -1.600 0.000
breast carcinoma -1.500 0.000
fibroadenoma -1.200 0.027
sonic hedgehog group medulloblastoma 1.600 0.000
primary Sjogren syndrome 1.300 0.007
lung adenocarcinoma -1.600 0.000
lung carcinoma -2.200 0.000
ulcerative colitis -1.500 0.000
ovarian cancer -3.000 0.000
dermatomyositis 1.100 0.002

Synonym

Accession Q8NBQ5 Q96HF6 Q9UKU4
Symbols DHRS8
PAN1B
RETSDR2
SDR16C2
17BHSD11
17-BETA-HSD11
17-BETA-HSDXI

Gene

PANTHER Protein Class (2)

PDB

1YB1  

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid

Gene RIF (5)

PMID Text
26472732 knowledge of its in vitro activity together with a newly described expression pattern at the protein level in tissues involved in steroidogenesis and detoxification could suggest a potential role of DHRS8 in vivo
21549806 hydroxysteroid (17-beta) dehydrogenase 11 transcription in prostate cancer cells is regulated by Sp1 transcription factor and C-EBP alpha
19469652 Increased Pan1b is associated with prostate cancer of seminal vesicle invasion.
18804447 Mutation analyses suggest that the PAT-like motif in 17betaHSD11 will not be functionally similar to the canonical PAT motif.
12697717 Role for 17-beta-HSDXI in androgen metabolism during steroidogenesis.

AA Sequence

MKFLLDILLLLPLLIVCSLESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINK      1 - 70
HGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKT     71 - 140
FEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITG    141 - 210
VKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAV    211 - 280
LKQKISVKFDAVIGYKMKAQ                                                      281 - 300
//

Text Mined References (22)

PMID Year Title
26472732 2016 Human dehydrogenase/reductase (SDR family) member 8 (DHRS8): a description and evaluation of its biochemical properties.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23568457 2013 Genetic variants associated with disordered eating.
21549806 2011 Transcriptional regulation of type 11 17?-hydroxysteroid dehydrogenase expression in prostate cancer cells.
21269460 2011 Initial characterization of the human central proteome.
19469652 2009 17beta-hydroxysteroid dehydrogenase type 11 (Pan1b) expression in human prostate cancer.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
18804447 2008 Identification and characterization of the ER/lipid droplet-targeting sequence in 17beta-hydroxysteroid dehydrogenase type 11.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
More...