Property Summary

NCBI Gene PubMed Count 348
Grant Count 86
R01 Count 40
Funding $16,537,676.19
PubMed Score 1328.41
PubTator Score 891.42

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8NBP7 A8T640 C0JYY9 Q5PSM5 Q5SZQ2
Symbols FH3
PC9
NARC1
LDLCQ1
NARC-1
HCHOLA3

Gene

PANTHER Protein Class (3)

PDB

2W2M   2W2N   2W2O   2W2P   2W2Q   3BPS   3GCW   3GCX   3M0C   3P5B   3P5C   4NE9   2P4E   2PMW   2QTW   2XTJ   3H42   3SQO   4K8R   4NMX   4OV6  

Gene RIF (336)

PMID Text
27015087 Three polymorphisms in the 3' UTR region of LDLR, c.*52G>A, c.*504G>A, and c.*773A>G, and two at the 5' UTR region of PCSK9, c.-3383C>G and c.-2063A>G, were associated with response to Armolipid Plus
26896437 Serum PCSK9 concentration is associated with future risk of cardiovascular disease even after adjustments for established risk factors.
26833058 Polydatin ameliorates lipid and glucose metabolism in type 2 diabetes mellitus by downregulating PCSK9
26824363 Data show that leptin replacement decreased proprotein convertase subtilisin/kexin type 9 (PCSK9) and improved lipid parameters in female lipodystrophic subject.
26820623 Thrombotic antiphospholipid antibody carriers showed significant association with PCSK9 gene, a regulator of LDLR plasma levels.
26691006 PCSK9 could serve as a novel molecular biomarker for the non-invasive prenatal screening of neural tube defects.
26687699 Familial hypercholesterolemia individuals carry the PCSK9-InsLEU genetic variant benefit of lower risk of coronary events but show an increased occurrence of prediabetes and diabetes
26668321 Data suggest that PCSK9 is involved in regulation of lipid metabolism in hepatocytes by proinflammatory cytokine TNFalpha; induction of lipogenesis and insulin resistance in liver (as seen in obesity) involves up-regulation of both PCSK9 and SOCS3.
26666837 the current meta-analysis highlighted that variant allele of OLR1 rs11053646 G > C and PCSK9 rs505151 A > G may contribute to the susceptibility risk of ischemic stroke.
26632531 These data demonstrate that serum Lp(a) is elevated in patients with FH caused by PCSK9 gain-of-function mutations to the same level as that in FH caused by LDLR mutations.
More...

AA Sequence

MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKD      1 - 70
PWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHV     71 - 140
DYIEEDSSVFAQSIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPE    141 - 210
EDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPV    211 - 280
GPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGT    281 - 350
LGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSA    351 - 420
KDVINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCAPDEELLSCSSFS    421 - 490
RSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLT    491 - 560
GCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGW    561 - 630
TLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ            631 - 692
//

Text Mined References (356)

PMID Year Title
27015087 2016 Genetic Variants of LDLR and PCSK9 Associated with Variations in Response to Antihypercholesterolemic Effects of Armolipid Plus with Berberine.
26896437 2016 Circulating Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9) Predicts Future Risk of Cardiovascular Events Independently of Established Risk Factors.
26833058 2016 Polydatin ameliorates lipid and glucose metabolism in type 2 diabetes mellitus by downregulating proprotein convertase subtilisin/kexin type 9 (PCSK9).
26824363 2016 Effect of Leptin Replacement on PCSK9 in ob/ob Mice and Female Lipodystrophic Patients.
26820623 2016 LDLR and PCSK9 Are Associated with the Presence of Antiphospholipid Antibodies and the Development of Thrombosis in aPLA Carriers.
26691006 2015 Identification of PCSK9 as a novel serum biomarker for the prenatal diagnosis of neural tube defects using iTRAQ quantitative proteomics.
26687699 Familial hypercholesterolemia: PCSK9 InsLEU genetic variant and prediabetes/diabetes risk.
26668321 2016 Suppressor of Cytokine Signaling-3 (SOCS-3) Induces Proprotein Convertase Subtilisin Kexin Type 9 (PCSK9) Expression in Hepatic HepG2 Cell Line.
26666837 2015 The Influence of OLR1 and PCSK9 Gene Polymorphisms on Ischemic Stroke: Evidence from a Meta-Analysis.
26632531 2016 Lipoprotein(a) in Familial Hypercholesterolemia With Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9) Gain-of-Function Mutations.
More...