Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.82
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8NBN7 Q6UX79 Q96G88
Symbols SDR7C3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MSRYLLPLSALGTVAGAAVLLKDYVTGGACPSKATIPGKTVIVTGANTGIGKQTALELARRGGNIILACR      1 - 70
DMEKCEAAAKDIRGETLNHHVNARHLDLASLKSIREFAAKIIEEEERVDILINNAGVMRCPHWTTEDGFE     71 - 140
MQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWQTRKYNTKAAYCQSKLAIVLF    141 - 210
TKELSRRLQGSGVTVNALHPGVARTELGRHTGIHGSTFSSTTLGPIFWLLVKSPELAAQPSTYLAVAEEL    211 - 280
ADVSGKYFDGLKQKAPAPEAEDEEVARRLWAESARLVGLEAPSVREQPLPR                       281 - 331
//

Text Mined References (15)

PMID Year Title