Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.53
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
breast carcinoma 1614 1.89014969541004E-13
non-small cell lung cancer 2798 2.07043775110068E-13
ependymoma 2514 8.01307905951073E-9
pilocytic astrocytoma 3086 2.06485481004724E-8
pediatric high grade glioma 2712 7.62756471982944E-7
glioblastoma 5572 1.42981333140492E-5
oligodendroglioma 2849 1.71158564039434E-5
atypical teratoid / rhabdoid tumor 4369 7.81638643371387E-5
pituitary cancer 1972 1.07533533506185E-4
medulloblastoma 1524 2.1768192123828E-4
medulloblastoma, large-cell 6234 7.68642782649802E-4
subependymal giant cell astrocytoma 2287 0.0026309793000742
ductal carcinoma in situ 1745 0.00788721322455847
primitive neuroectodermal tumor 3031 0.0102985998175858
ovarian cancer 8492 0.0146787857448374
astrocytic glioma 2241 0.0190886634791186
invasive ductal carcinoma 2950 0.0211990604468949
Breast cancer 3099 0.0286441725888371

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -1.400 0.019
glioblastoma -3.700 0.000
oligodendroglioma -1.200 0.000
ependymoma -2.900 0.000
medulloblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -3.600 0.001
primitive neuroectodermal tumor -2.300 0.010
non-small cell lung cancer -2.133 0.000
Breast cancer -1.900 0.029
pediatric high grade glioma -3.200 0.000
pilocytic astrocytoma -2.900 0.000
subependymal giant cell astrocytoma -3.995 0.003
breast carcinoma -1.500 0.000
ductal carcinoma in situ -2.100 0.008
invasive ductal carcinoma -2.400 0.021
ovarian cancer 1.200 0.015
pituitary cancer 2.100 0.000

Synonym

Accession Q8NBL3 Q6UWI6 Q8N6N4
Symbols TMEM178

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum EggNOG Inparanoid

Gene RIF (1)

PMID Text
26644563 Tmem178 localizes to the ER membrane and regulates RANKL-induced Ca(2+) fluxes, thus controlling NFATc1 induction

AA Sequence

MEPRALVTALSLGLSLCSLGLLVTAIFTDHWYETDPRRHKESCERSRAGADPPDQKNRLMPLSHLPLRDS      1 - 70
PPLGRRLLPGGPGRADPESWRSLLGLGGLDAECGRPLFATYSGLWRKCYFLGIDRDIDTLILKGIAQRCT     71 - 140
AIKYHFSQPIRLRNIPFNLTKTIQQDEWHLLHLRRITAGFLGMAVAVLLCGCIVATVSFFWEESLTQHVA    141 - 210
GLLFLMTGIFCTISLCTYAASISYDLNRLPKLIYSLPADVEHGYSWSIFCAWCSLGFIVAAGGLCIAYPF    211 - 280
ISRTKIAQLKSGRDSTV                                                         281 - 297
//

Text Mined References (8)

PMID Year Title
26644563 2015 Tmem178 acts in a novel negative feedback loop targeting NFATc1 to regulate bone mass.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.