Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.53
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.600 1.1e-02
astrocytic glioma -1.400 1.9e-02
Astrocytoma, Pilocytic -2.900 1.5e-08
atypical teratoid / rhabdoid tumor -2.300 7.8e-05
Breast cancer -1.900 2.9e-02
breast carcinoma -1.500 1.9e-13
ductal carcinoma in situ -2.100 7.9e-03
ependymoma -2.900 8.0e-09
glioblastoma -2.300 1.6e-04
group 4 medulloblastoma -1.100 2.4e-02
invasive ductal carcinoma -2.400 2.1e-02
medulloblastoma, large-cell -3.600 7.7e-04
non-small cell lung cancer -2.133 2.1e-13
oligodendroglioma -1.200 1.7e-05
ovarian cancer 1.200 1.5e-02
pituitary cancer 2.100 1.1e-04
primitive neuroectodermal tumor -2.300 1.0e-02
subependymal giant cell astrocytoma -3.995 2.6e-03

Gene RIF (1)

AA Sequence

MEPRALVTALSLGLSLCSLGLLVTAIFTDHWYETDPRRHKESCERSRAGADPPDQKNRLMPLSHLPLRDS      1 - 70
PPLGRRLLPGGPGRADPESWRSLLGLGGLDAECGRPLFATYSGLWRKCYFLGIDRDIDTLILKGIAQRCT     71 - 140
AIKYHFSQPIRLRNIPFNLTKTIQQDEWHLLHLRRITAGFLGMAVAVLLCGCIVATVSFFWEESLTQHVA    141 - 210
GLLFLMTGIFCTISLCTYAASISYDLNRLPKLIYSLPADVEHGYSWSIFCAWCSLGFIVAAGGLCIAYPF    211 - 280
ISRTKIAQLKSGRDSTV                                                         281 - 297
//

Text Mined References (8)

PMID Year Title