Property Summary

NCBI Gene PubMed Count 21
PubMed Score 24.58
PubTator Score 29.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.039 3.0e-08
group 3 medulloblastoma 1.500 4.9e-04
juvenile dermatomyositis 1.081 1.4e-11
lung cancer 1.200 3.5e-02
nasopharyngeal carcinoma 1.300 1.3e-03
ovarian cancer -1.400 1.9e-04
primitive neuroectodermal tumor 1.100 9.8e-04

Protein-protein Interaction (8)

Gene RIF (10)

AA Sequence

MEWWASSPLRLWLLLFLLPSAQGRQKESGSKWKVFIDQINRSLENYEPCSSQNCSCYHGVIEEDLTPFRG      1 - 70
GISRKMMAEVVRRKLGTHYQITKNRLYRENDCMFPSRCSGVEHFILEVIGRLPDMEMVINVRDYPQVPKW     71 - 140
MEPAIPVFSFSKTSEYHDIMYPAWTFWEGGPAVWPIYPTGLGRWDLFREDLVRSAAQWPWKKKNSTAYFR    141 - 210
GSRTSPERDPLILLSRKNPKLVDAEYTKNQAWKSMKDTLGKPAAKDVHLVDHCKYKYLFNFRGVAASFRF    211 - 280
KHLFLCGSLVFHVGDEWLEFFYPQLKPWVHYIPVKTDLSNVQELLQFVKANDDVAQEIAERGSQFIRNHL    281 - 350
QMDDITCYWENLLSEYSKFLSYNVTRRKGYDQIIPKMLKTEL                                351 - 392
//

Text Mined References (25)

PMID Year Title