Property Summary

NCBI Gene PubMed Count 35
PubMed Score 157.74
PubTator Score 58.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 8.8e-05
ependymoma 1.200 1.8e-07
group 4 medulloblastoma -1.100 7.2e-03
intraductal papillary-mucinous neoplasm ... 1.300 8.9e-03
ovarian cancer -1.200 4.6e-04
subependymal giant cell astrocytoma 2.100 1.3e-02
tuberculosis 1.200 5.1e-06

Gene RIF (23)

AA Sequence

MAAPALGLVCGRCPELGLVLLLLLLSLLCGAAGSQEAGTGAGAGSLAGSCGCGTPQRPGAHGSSAAAHRY      1 - 70
SREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFV     71 - 140
NSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVS    141 - 210
WNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAP    211 - 280
VDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARS    281 - 350
QNTPDSSASNLGFRCAADRLPTMD                                                  351 - 374
//

Text Mined References (37)

PMID Year Title