Property Summary

NCBI Gene PubMed Count 19
PubMed Score 2003.50
PubTator Score 451.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.200 2.5e-03

Gene RIF (7)

AA Sequence

MARHGLPLLPLLSLLVGAWLKLGNGQATSMVQLQGGRFLMGTNSPDSRDGDGPVREATVKPFAIDIFPVT      1 - 70
NKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLPVEKAFWRQPAGPGSGIRERL     71 - 140
EHPVLHVSWNDARAYCAWRGKRLPTEEEWEFAARGGLKGQVYPWGNWFQPNRTNLWQGKFPKGDKAEDGF    141 - 210
HGVSPVNAFPAQNNYGLYDLLGNVWEWTASPYQAAEQDMRVLRGASWIDTADGSANHRARVTTRMGNTPD    211 - 280
SASDNLGFRCAADAGRPPGEL                                                     281 - 301
//

Text Mined References (24)

PMID Year Title