Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.22
PubTator Score 3.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 1.200 5.5e-05
diabetes mellitus -1.100 3.9e-02
glioblastoma 1.400 1.8e-02
intraductal papillary-mucinous neoplasm ... 1.100 1.6e-03
lung carcinoma -1.100 1.6e-13
osteosarcoma 1.605 3.6e-05
ovarian cancer 1.200 3.7e-04
tuberculosis 1.200 1.8e-09

Synonym

Accession Q8NBJ5 Q8NC64
Symbols GLT25D1
ColGalT 1

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

AA Sequence

MAAAPRAGRRRGQPLLALLLLLLAPLPPGAPPGADAYFPEERWSPESPLQAPRVLIALLARNAAHALPTT      1 - 70
LGALERLRHPRERTALWVATDHNMDNTSTVLREWLVAVKSLYHSVEWRPAEEPRSYPDEEGPKHWSDSRY     71 - 140
EHVMKLRQAALKSARDMWADYILFVDADNLILNPDTLSLLIAENKTVVAPMLDSRAAYSNFWCGMTSQGY    141 - 210
YKRTPAYIPIRKRDRRGCFAVPMVHSTFLIDLRKAASRNLAFYPPHPDYTWSFDDIIVFAFSCKQAEVQM    211 - 280
YVCNKEEYGFLPVPLRAHSTLQDEAESFMHVQLEVMVKHPPAEPSRFISAPTKTPDKMGFDEVFMINLRR    281 - 350
RQDRRERMLRALQAQEIECRLVEAVDGKAMNTSQVEALGIQMLPGYRDPYHGRPLTKGELGCFLSHYNIW    351 - 420
KEVVDRGLQKSLVFEDDLRFEIFFKRRLMNLMRDVEREGLDWDLIYVGRKRMQVEHPEKAVPRVRNLVEA    421 - 490
DYSYWTLAYVISLQGARKLLAAEPLSKMLPVDEFLPVMFDKHPVSEYKAHFSLRNLHAFSVEPLLIYPTH    491 - 560
YTGDDGYVSDTETSVVWNNEHVKTDWDRAKSQKMREQQALSREAKNSDVLQSPLDSAARDEL            561 - 622
//

Text Mined References (14)

PMID Year Title