Property Summary

NCBI Gene PubMed Count 79
Grant Count 30
R01 Count 15
Funding $3,364,251.83
PubMed Score 107.75
PubTator Score 124.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma 1.400 0.043
Barrett's esophagus 3.000 0.042
esophageal adenocarcinoma 3.600 0.018
psoriasis -1.600 0.005
posterior fossa group B ependymoma 1.500 0.000
tuberculosis 1.500 0.000
primary pancreatic ductal adenocarcinoma 1.387 0.039
non-small cell lung cancer 1.915 0.000
pancreatic cancer 1.600 0.021
breast carcinoma 1.400 0.000
lung adenocarcinoma 2.335 0.000
pilocytic astrocytoma 1.400 0.000
lung carcinoma 1.400 0.000
ductal carcinoma in situ 1.700 0.001
ovarian cancer -2.600 0.000

Gene RIF (66)

PMID Text
26617863 Serum GP73 had limited diagnostic value for HBV-related liver cancer. The combined use of serum GP73 and AFP levels improved the diagnostic efficacy.
26583119 the specific antibody could block the binding of A10-2 to GP73, and the specific binding of A10-2 to GP73 was also supported by the observation that several tumor cell lines exhibited variable expression level of GP73.
26461057 GOLPH2 may be a useful tissue biomarker for oesophageal disease.
26441340 The results of this meta-analysis showed that serum GP73 + AFP exhibited significantly higher diagnostic accuracy for HCC than did serum GP73 or AFP alone.
26406957 GP73 and AFP-L3 are superior biomarkers to aid the diagnosis of small PHC with negative AFP. The combined detection of biomarkers improved the diagnostic accuracy.
26378022 GP73 enhances MMP-13 expression through cAMP responsive element binding protein (CREB)-mediated transcription activation. Levels of GP73 and MMP-13 are increased and positively correlated in human HCC tissues. Augmented MMP-13 potentiates HCC cell metastasis.
26256086 Transcatheter arterial chemoembolization significantly increased GP73 expression in patients with hepatocellular carcinoma.
26125916 Sublingual vein parameters and AFP, AFP-L3, and GP73 serum gene expression facilitate early diagnosis of patients with hepatocellular carcinoma.
25980751 Increased expression of GP73 promotes proliferation and migration of hepatocellular carcinoma cell lines and growth of xenograft tumors in mice.
25527157 GP73 may play an important role in the inhibitory regulation of autophagy.
More...

AA Sequence

MMGLGNGRRSMKSPPLVLAALVACIIVLGFNYWIASSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEF      1 - 70
QGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQ     71 - 140
FQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRL    141 - 210
QAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVV    211 - 280
EDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDD    281 - 350
YNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL                       351 - 401
//

Text Mined References (84)

PMID Year Title
26617863 2015 Diagnostic value of serum Golgi protein 73 for HBV-related primary hepatic carcinoma.
26583119 2015 Screening and Identification of ssDNA Aptamer for Human GP73.
26461057 2015 Golgi phosphoprotein 2 (GOLPH2) is a novel bile acid-responsive modulator of oesophageal cell migration and invasion.
26441340 2015 Diagnostic Value of the Combination of Golgi Protein 73 and Alpha-Fetoprotein in Hepatocellular Carcinoma: A Meta-Analysis.
26406957 2015 Significance of combined tests of serum golgi glycoprotein 73 and other biomarkers in diagnosis of small primary hepatocellular carcinoma.
26378022 2015 Golgi protein 73 activation of MMP-13 promotes hepatocellular carcinoma cell invasion.
26256086 2015 The response of Golgi protein 73 to transcatheter arterial chemoembolization in patients with hepatocellular carcinoma may relate to the influence of certain chemotherapeutics.
26125916 2015 Sublingual vein parameters, AFP, AFP-L3, and GP73 in patients with hepatocellular carcinoma.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25980751 2015 mTORC1 Up-Regulates GP73 to Promote Proliferation and Migration of Hepatocellular Carcinoma Cells and Growth of Xenograft Tumors in Mice.
More...