Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.54
PubTator Score 2.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
non-small cell lung cancer 2890 3.1e-14
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 0.9
lung cancer 4740 0.0 3.0
Disease Target Count Z-score Confidence
Goldenhar syndrome 20 4.132 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
non-small cell lung cancer 1.552 3.1e-14

AA Sequence

MGLLRGGLPCARAMARLGAVRSHYCALLLAAALAVCAFYYLGSGRETFSSATKRLKEARAGAPAAPSPPA      1 - 70
LELARGSVAPAPGAKAKSLEGGGAGPVDYHLLMMFTKAEHNAALQAKARVALRSLLRLAKFEAHEVLNLH     71 - 140
FVSEEASREVAKGLLRELLPPAAGFKCKVIFHDVAVLTDKLFPIVEAMQKHFSAGLGTYYSDSIFFLSVA    141 - 210
MHQIMPKEILQIIQLDLDLKFKTNIRELFEEFDSFLPGAIIGIAREMQPVYRHTFWQFRHENPQTRVGGP    211 - 280
PPEGLPGFNSGVMLLNLEAMRQSPLYSRLLEPAQVQQLADKYHFRGHLGDQDFFTMIGMEHPKLFHVLDC    281 - 350
TWNRQLCTWWRDHGYSDVFEAYFRCEGHVKIYHGNCNTPIPED                               351 - 393
//

Text Mined References (8)

PMID Year Title