Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.68
PubTator Score 2.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
non-small cell lung cancer 1.552 0.000

Synonym

Accession Q8NBI6 D3DNW5 Q8NAL3 Q8WV03 Q96ME0
Symbols C3orf21

Gene

PANTHER Protein Class (2)

AA Sequence

MGLLRGGLPCARAMARLGAVRSHYCALLLAAALAVCAFYYLGSGRETFSSATKRLKEARAGAPAAPSPPA      1 - 70
LELARGSVAPAPGAKAKSLEGGGAGPVDYHLLMMFTKAEHNAALQAKARVALRSLLRLAKFEAHEVLNLH     71 - 140
FVSEEASREVAKGLLRELLPPAAGFKCKVIFHDVAVLTDKLFPIVEAMQKHFSAGLGTYYSDSIFFLSVA    141 - 210
MHQIMPKEILQIIQLDLDLKFKTNIRELFEEFDSFLPGAIIGIAREMQPVYRHTFWQFRHENPQTRVGGP    211 - 280
PPEGLPGFNSGVMLLNLEAMRQSPLYSRLLEPAQVQQLADKYHFRGHLGDQDFFTMIGMEHPKLFHVLDC    281 - 350
TWNRQLCTWWRDHGYSDVFEAYFRCEGHVKIYHGNCNTPIPED                               351 - 393
//

Text Mined References (8)

PMID Year Title
22117070 2012 Molecular cloning of a xylosyltransferase that transfers the second xylose to O-glucosylated epidermal growth factor repeats of notch.
20876614 2010 A genome-wide association study reveals susceptibility variants for non-small cell lung cancer in the Korean population.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8982869 1996 Detection of UDP-D-xylose: alpha-D-xyloside alpha 1-->3xylosyltransferase activity in human hepatoma cell line HepG2.