Property Summary

NCBI Gene PubMed Count 7
Grant Count 5
Funding $169,637.9
PubMed Score 4.05
PubTator Score 3.76

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
26527604 transcriptome sequencing of patient-derived angiosarcoma cells, identified a novel fusion gene NUP160-SLC43A3 found to be expressed in 9 of 25 human angiosarcoma specimens that were examined.
26455426 SLC43A3 is an equilibrative nucleobase transporter involved in purine salvage in mammals.

AA Sequence

MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPDAGPIGNATGQADCKAQDERF      1 - 70
SLIFTLGSFMNNFMTFPTGYIFDRFKTTVARLIAIFFYTTATLIIAFTSAGSAVLLFLAMPMLTIGGILF     71 - 140
LITNLQIGNLFGQHRSTIITLYNGAFDSSSAVFLIIKLLYEKGISLRASFIFISVCSTWHVARTFLLMPR    141 - 210
GHIPYPLPPNYSYGLCPGNGTTKEEKETAEHENRELQSKEFLSAKEETPGAGQKQELRSFWSYAFSRRFA    211 - 280
WHLVWLSVIQLWHYLFIGTLNSLLTNMAGGDMARVSTYTNAFAFTQFGVLCAPWNGLLMDRLKQKYQKEA    281 - 350
RKTGSSTLAVALCSTVPSLALTSLLCLGFALCASVPILPLQYLTFILQVISRSFLYGSNAAFLTLAFPSE    351 - 420
HFGKLFGLVMALSAVVSLLQFPIFTLIKGSLQNDPFYVNVMFMLAILLTFFHPFLVYRECRTWKESPSAI    421 - 490
A//

Text Mined References (14)

PMID Year Title
26527604 2015 NUP160-SLC43A3 is a novel recurrent fusion oncogene in angiosarcoma.
26455426 2015 Functional identification of SLC43A3 as an equilibrative nucleobase transporter involved in purine salvage in mammals.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...