Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.13
PubTator Score 3.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma 2.000 2.4e-06
Astrocytoma, Pilocytic 2.200 1.3e-12
atypical teratoid / rhabdoid tumor 1.500 4.5e-04
ependymoma 1.600 2.6e-10
facioscapulohumeral dystrophy -1.700 4.7e-02
gastric carcinoma 1.700 1.3e-02
glioblastoma 2.100 1.8e-09
group 3 medulloblastoma 1.600 4.5e-03
lung cancer -2.300 2.4e-04
malignant mesothelioma 1.600 1.9e-07
medulloblastoma, large-cell 2.300 5.0e-05
osteosarcoma -1.628 6.4e-04
ovarian cancer 1.300 8.2e-06
pancreatic ductal adenocarcinoma liver m... -1.372 1.3e-02
primitive neuroectodermal tumor 1.300 4.9e-02
subependymal giant cell astrocytoma 1.182 2.2e-02
tuberculosis -1.700 2.3e-05
ulcerative colitis 1.500 8.7e-07

Gene RIF (2)

AA Sequence

MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPDAGPIGNATGQADCKAQDERF      1 - 70
SLIFTLGSFMNNFMTFPTGYIFDRFKTTVARLIAIFFYTTATLIIAFTSAGSAVLLFLAMPMLTIGGILF     71 - 140
LITNLQIGNLFGQHRSTIITLYNGAFDSSSAVFLIIKLLYEKGISLRASFIFISVCSTWHVARTFLLMPR    141 - 210
GHIPYPLPPNYSYGLCPGNGTTKEEKETAEHENRELQSKEFLSAKEETPGAGQKQELRSFWSYAFSRRFA    211 - 280
WHLVWLSVIQLWHYLFIGTLNSLLTNMAGGDMARVSTYTNAFAFTQFGVLCAPWNGLLMDRLKQKYQKEA    281 - 350
RKTGSSTLAVALCSTVPSLALTSLLCLGFALCASVPILPLQYLTFILQVISRSFLYGSNAAFLTLAFPSE    351 - 420
HFGKLFGLVMALSAVVSLLQFPIFTLIKGSLQNDPFYVNVMFMLAILLTFFHPFLVYRECRTWKESPSAI    421 - 490
A//

Text Mined References (14)

PMID Year Title