Property Summary

NCBI Gene PubMed Count 12
Grant Count 2
Funding $396,087
PubMed Score 16.15
PubTator Score 4.40

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
24832731 results suggest that draxin functions as a repulsive guidance cue for PCN migration. However, we observed no significant differences in PCN distribution between draxin(-/-) and wild type embryos.
19857465 Neucrin is a unique secreted Wnt antagonist that is predominantly expressed in developing neural tissues.

AA Sequence

MAGPAIHTAPMLFLVLLLPLELSLAGALAPGTPARNLPENHIDLPGPALWTPQASHHRRRGPGKKEWGPG      1 - 70
LPSQAQDGAVVTATRQASRLPEAEGLLPEQSPAGLLQDKDLLLGLALPYPEKENRPPGWERTRKRSREHK     71 - 140
RRRDRLRLHQGRALVRGPSSLMKKAELSEAQVLDAAMEESSTSLAPTMFFLTTFEAAPATEESLILPVTS    141 - 210
LRPQQAQPRSDGEVMPTLDMALFDWTDYEDLKPDGWPSAKKKEKHRGKLSSDGNETSPAEGEPCDHHQDC    211 - 280
LPGTCCDLREHLCTPHNRGLNNKCFDDCMCVEGLRCYAKFHRNRRVTRRKGRCVEPETANGDQGSFINV     281 - 349
//

Text Mined References (12)

PMID Year Title
26190107 2015 A Floor-Plate Extracellular Protein-Protein Interaction Screen Identifies Draxin as a Secreted Netrin-1 Antagonist.
24832731 2014 Inhibitory effects of draxin on axonal outgrowth and migration of precerebellar neurons.
19857465 2009 Neucrin is a novel neural-specific secreted antagonist to canonical Wnt signaling.
19150847 2009 Draxin, a repulsive guidance protein for spinal cord and forebrain commissures.
18347602 2008 Genomewide association for schizophrenia in the CATIE study: results of stage 1.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...