Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.14
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 2.1566971089514E-5
adrenocortical carcinoma 1427 2.86586847570198E-5
osteosarcoma 7933 4.16889259824876E-5
pancreatic cancer 2300 0.00218971307021281
primary pancreatic ductal adenocarcinoma 1271 0.00442637926719536
aldosterone-producing adenoma 664 0.0201001936110366
ependymoma 2514 0.0273293488455836

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.200 0.027
osteosarcoma -1.701 0.000
atypical teratoid / rhabdoid tumor 1.100 0.000
adrenocortical carcinoma -1.784 0.000
primary pancreatic ductal adenocarcinoma 1.221 0.004
aldosterone-producing adenoma -1.436 0.020
pancreatic cancer 1.100 0.002

Synonym

Accession Q8NBI2 B3KPU2 B4DLN9 J3KQH4 Q6PK96
Symbols LCYTB
CYBASC3

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG

Pathway (1)

AA Sequence

MVSGRFYLSCLLLGSLGSMCILFTIYWMQYWRGGFAWNGSIYMFNWHPVLMVAGMVVFYGGASLVYRLPQ      1 - 70
SWVGPKLPWKLLHAALHLMAFVLTVVGLVAVFTFHNHGRTANLYSLHSWLGITTVFLFACQWFLGFAVFL     71 - 140
LPWASMWLRSLLKPIHVFFGAAILSLSIASVISGINEKLFFSLKNTTRPYHSLPSEAVFANSTGMLVVAF    141 - 210
GLLVLYILLASSWKRPEPGILTDRQPLLHDGE                                          211 - 242
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23249217 2013 Cytochromes b561: ascorbate-mediated trans-membrane electron transport.
17897319 2007 Integral and associated lysosomal membrane proteins.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...