Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.14
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.200 0.027
osteosarcoma -1.701 0.000
atypical teratoid / rhabdoid tumor 1.100 0.000
adrenocortical carcinoma -1.784 0.000
primary pancreatic ductal adenocarcinoma 1.221 0.004
aldosterone-producing adenoma -1.436 0.020
pancreatic cancer 1.100 0.002

Synonym

Accession Q8NBI2 B3KPU2 B4DLN9 J3KQH4 Q6PK96
Symbols LCYTB
CYBASC3

Gene

PANTHER Protein Class (2)

AA Sequence

MVSGRFYLSCLLLGSLGSMCILFTIYWMQYWRGGFAWNGSIYMFNWHPVLMVAGMVVFYGGASLVYRLPQ      1 - 70
SWVGPKLPWKLLHAALHLMAFVLTVVGLVAVFTFHNHGRTANLYSLHSWLGITTVFLFACQWFLGFAVFL     71 - 140
LPWASMWLRSLLKPIHVFFGAAILSLSIASVISGINEKLFFSLKNTTRPYHSLPSEAVFANSTGMLVVAF    141 - 210
GLLVLYILLASSWKRPEPGILTDRQPLLHDGE                                          211 - 242
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23249217 2013 Cytochromes b561: ascorbate-mediated trans-membrane electron transport.
17897319 2007 Integral and associated lysosomal membrane proteins.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...