Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.21
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adrenocortical carcinoma -1.784 2.9e-05
aldosterone-producing adenoma -1.436 2.0e-02
atypical teratoid / rhabdoid tumor 1.100 2.2e-05
ependymoma 1.200 2.7e-02
osteosarcoma -1.701 4.2e-05
pancreatic cancer 1.100 2.2e-03
primary pancreatic ductal adenocarcinoma 1.221 4.4e-03

AA Sequence

MVSGRFYLSCLLLGSLGSMCILFTIYWMQYWRGGFAWNGSIYMFNWHPVLMVAGMVVFYGGASLVYRLPQ      1 - 70
SWVGPKLPWKLLHAALHLMAFVLTVVGLVAVFTFHNHGRTANLYSLHSWLGITTVFLFACQWFLGFAVFL     71 - 140
LPWASMWLRSLLKPIHVFFGAAILSLSIASVISGINEKLFFSLKNTTRPYHSLPSEAVFANSTGMLVVAF    141 - 210
GLLVLYILLASSWKRPEPGILTDRQPLLHDGE                                          211 - 242
//

Text Mined References (13)

PMID Year Title