Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Myofibrillar Myopathy 9 0.0 0.0
Disease Target Count P-value
intraductal papillary-mucinous neoplasm (IPMN) 3291 4.2e-02
Disease Target Count Z-score Confidence
Myopathy 185 0.0 4.0
Disease Target Count Z-score Confidence
Congenital myopathy 16 4.025 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... -1.100 4.2e-02

Gene RIF (5)

AA Sequence

MELKKDINAVSIDMLLIVHSEKRRAAQGTLSDQQANPSSLLQRGGGFQGVGNGVRRWQKLEGNDFHENLV      1 - 70
EKQHPQQPQVITSYNSQGTQLTVEVHPRDAMPQLLKKFSLAKRLQGDKNGNTRPRQPGGKDAHAYPWDRS     71 - 140
SLKSMSLDLQQFEKLDIYASQVTAKSGLDELVSDLLQEAHTDLERVRAIWIWICHHIEYDIAAAQEKDRQ    141 - 210
AFKPTDILRTQKTNCDGYAGLFERMCRLAGVQCMTVPGYSKGFGYQTGQSFSGEFDHAWNAVYLEGRWHL    211 - 280
VDSTWGSGLVDTITSKFTFLYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENNMYHKSEFYNKG    281 - 350
MLSAHPETSMIRTVNGKATVTIESCAPTLFMFMLNGKQEHGLLSLRKNGMKLEVYPPTMGTHKLQIFAKG    351 - 420
NSDIYSSVLEYTLKCNYVDMGVQLPAELHQPVGPSWFSEQMGIMKPSHPDPIIHTSDGRCSISFSVEEGI    421 - 490
NVLASLHGDDGPITEETQRRYIFQLHREKQTELKVQLPHAGKFALKIYVMVLENANHNFYSYILKYKVNA    491 - 560
Q//

Text Mined References (10)

PMID Year Title