Property Summary

NCBI Gene PubMed Count 12
Grant Count 10
Funding $1,903,234.76
PubMed Score 10.01
PubTator Score 8.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.798 0.000
Hydrolethalus syndrome 1.103 0.039
group 3 medulloblastoma -1.100 0.004
ovarian cancer 1.100 0.000
psoriasis -1.200 0.000

Gene RIF (5)

PMID Text
24383088 These results suggest that the hypoxic signaling pathway may play a pivotal role in regulating the reprogramming factor GLIS1, via non-canonical mechanisms involving partner transcription factor rather than by direct HIF transactivation.
22759478 found that allele 'A' of rs797906 SNP increases the risk for late-onset Parkinson Disease in the Han Chinese population.
21654807 results therefore show that Glis1 effectively promotes the direct reprogramming of somatic cells during iPSC generation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16417217 Transcriptional factor Glis1 is involved in the regulation of aberrant differentiation observed in psoriatic epidermis.

AA Sequence

MAEARTSLSAHCRGPLATGLHPDLDLPGRSLATPAPSCYLLGSEPSSGLGLQPETHLPEGSLKRCCVLGL      1 - 70
PPTSPASSSPCASSDVTSIIRSSQTSLVTCVNGLRSPPLTGDLGGPSKRARPGPASTDSHEGSLQLEACR     71 - 140
KASFLKQEPADEFSELFGPHQQGLPPPYPLSQLPPGPSLGGLGLGLAGRVVAGRQACRWVDCCAAYEQQE    141 - 210
ELVRHIEKSHIDQRKGEDFTCFWAGCVRRYKPFNARYKLLIHMRVHSGEKPNKCMFEGCSKAFSRLENLK    211 - 280
IHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCSKRYTDPSSLRKHVKAHSAKE    281 - 350
QQVRKKLHAGPDTEADVLTECLVLQQLHTSTQLAASDGKGGCGLGQELLPGVYPGSITPHNGLASGLLPP    351 - 420
AHDVPSRHHPLDATTSSHHHLSPLPMAESTRDGLGPGLLSPIVSPLKGLGPPPLPPSSQSHSPGGQPFPT    421 - 490
LPSKPSYPPFQSPPPPPLPSPQGYQGSFHSIQSCFPYGDCYRMAEPAAGGDGLVGETHGFNPLRPNGYHS    491 - 560
LSTPLPATGYEALAEASCPTALPQQPSEDVVSSGPEDCGFFPNGAFDHCLGHIPSIYTDT              561 - 620
//

Text Mined References (14)

PMID Year Title
24383088 2013 The Krüppel-like zinc finger transcription factor, GLI-similar 1, is regulated by hypoxia-inducible factors via non-canonical mechanisms.
23942779 2013 A genome-wide association study of behavioral disinhibition.
22759478 2012 GLIS1 rs797906: an increased risk factor for late-onset Parkinson's disease in the Han Chinese population.
21654807 2011 Direct reprogramming of somatic cells is promoted by maternal transcription factor Glis1.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16417217 2006 Regulatory role for Krüppel-like zinc-finger protein Gli-similar 1 (Glis1) in PMA-treated and psoriatic epidermis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...