Property Summary

NCBI Gene PubMed Count 12
PubMed Score 11.44
PubTator Score 8.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 1.1e-23
ovarian cancer 8520 7.7e-06
osteosarcoma 7950 9.4e-05
group 3 medulloblastoma 4104 4.2e-03
Hydrolethalus syndrome 128 3.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Nephronophthisis 80 3.403 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma -1.100 4.2e-03
Hydrolethalus syndrome 1.103 3.9e-02
osteosarcoma 1.798 9.4e-05
ovarian cancer 1.100 7.7e-06
psoriasis -1.200 1.1e-23

Gene RIF (5)

AA Sequence

MAEARTSLSAHCRGPLATGLHPDLDLPGRSLATPAPSCYLLGSEPSSGLGLQPETHLPEGSLKRCCVLGL      1 - 70
PPTSPASSSPCASSDVTSIIRSSQTSLVTCVNGLRSPPLTGDLGGPSKRARPGPASTDSHEGSLQLEACR     71 - 140
KASFLKQEPADEFSELFGPHQQGLPPPYPLSQLPPGPSLGGLGLGLAGRVVAGRQACRWVDCCAAYEQQE    141 - 210
ELVRHIEKSHIDQRKGEDFTCFWAGCVRRYKPFNARYKLLIHMRVHSGEKPNKCMFEGCSKAFSRLENLK    211 - 280
IHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCSKRYTDPSSLRKHVKAHSAKE    281 - 350
QQVRKKLHAGPDTEADVLTECLVLQQLHTSTQLAASDGKGGCGLGQELLPGVYPGSITPHNGLASGLLPP    351 - 420
AHDVPSRHHPLDATTSSHHHLSPLPMAESTRDGLGPGLLSPIVSPLKGLGPPPLPPSSQSHSPGGQPFPT    421 - 490
LPSKPSYPPFQSPPPPPLPSPQGYQGSFHSIQSCFPYGDCYRMAEPAAGGDGLVGETHGFNPLRPNGYHS    491 - 560
LSTPLPATGYEALAEASCPTALPQQPSEDVVSSGPEDCGFFPNGAFDHCLGHIPSIYTDT              561 - 620
//

Text Mined References (14)

PMID Year Title