Property Summary

NCBI Gene PubMed Count 12
PubMed Score 10.01
PubTator Score 8.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 1.1337968388576E-23
ovarian cancer 8492 7.71850848788911E-6
osteosarcoma 7933 9.43504988998525E-5
group 3 medulloblastoma 2254 0.00415331164023265
Hydrolethalus syndrome 128 0.0390649831419579
Disease Target Count Z-score Confidence
Nephronophthisis 74 3.462 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.798 0.000
Hydrolethalus syndrome 1.103 0.039
group 3 medulloblastoma -1.100 0.004
ovarian cancer 1.100 0.000
psoriasis -1.200 0.000

Synonym

Accession Q8NBF1 Q2M3G9 Q8N9V9
Symbols

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid

Gene RIF (5)

PMID Text
24383088 These results suggest that the hypoxic signaling pathway may play a pivotal role in regulating the reprogramming factor GLIS1, via non-canonical mechanisms involving partner transcription factor rather than by direct HIF transactivation.
22759478 found that allele 'A' of rs797906 SNP increases the risk for late-onset Parkinson Disease in the Han Chinese population.
21654807 results therefore show that Glis1 effectively promotes the direct reprogramming of somatic cells during iPSC generation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16417217 Transcriptional factor Glis1 is involved in the regulation of aberrant differentiation observed in psoriatic epidermis.

AA Sequence

MAEARTSLSAHCRGPLATGLHPDLDLPGRSLATPAPSCYLLGSEPSSGLGLQPETHLPEGSLKRCCVLGL      1 - 70
PPTSPASSSPCASSDVTSIIRSSQTSLVTCVNGLRSPPLTGDLGGPSKRARPGPASTDSHEGSLQLEACR     71 - 140
KASFLKQEPADEFSELFGPHQQGLPPPYPLSQLPPGPSLGGLGLGLAGRVVAGRQACRWVDCCAAYEQQE    141 - 210
ELVRHIEKSHIDQRKGEDFTCFWAGCVRRYKPFNARYKLLIHMRVHSGEKPNKCMFEGCSKAFSRLENLK    211 - 280
IHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCSKRYTDPSSLRKHVKAHSAKE    281 - 350
QQVRKKLHAGPDTEADVLTECLVLQQLHTSTQLAASDGKGGCGLGQELLPGVYPGSITPHNGLASGLLPP    351 - 420
AHDVPSRHHPLDATTSSHHHLSPLPMAESTRDGLGPGLLSPIVSPLKGLGPPPLPPSSQSHSPGGQPFPT    421 - 490
LPSKPSYPPFQSPPPPPLPSPQGYQGSFHSIQSCFPYGDCYRMAEPAAGGDGLVGETHGFNPLRPNGYHS    491 - 560
LSTPLPATGYEALAEASCPTALPQQPSEDVVSSGPEDCGFFPNGAFDHCLGHIPSIYTDT              561 - 620
//

Text Mined References (14)

PMID Year Title
24383088 2013 The Krüppel-like zinc finger transcription factor, GLI-similar 1, is regulated by hypoxia-inducible factors via non-canonical mechanisms.
23942779 2013 A genome-wide association study of behavioral disinhibition.
22759478 2012 GLIS1 rs797906: an increased risk factor for late-onset Parkinson's disease in the Han Chinese population.
21654807 2011 Direct reprogramming of somatic cells is promoted by maternal transcription factor Glis1.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16417217 2006 Regulatory role for Krüppel-like zinc-finger protein Gli-similar 1 (Glis1) in PMA-treated and psoriatic epidermis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...