Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.64
PubTator Score 1.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.800 0.000
osteosarcoma 1.603 0.000
medulloblastoma 1.200 0.000
medulloblastoma, large-cell 1.600 0.000
intraductal papillary-mucinous neoplasm ... 1.500 0.032
lung cancer 2.200 0.000
subependymal giant cell astrocytoma -2.059 0.001
nasopharyngeal carcinoma 1.600 0.000
lung carcinoma 1.100 0.000
gastric carcinoma 1.400 0.024

AA Sequence

MALKGQEDYIYLFKDSTHPVDFLDAFRTFYLDGLFTDITLQCPSGIIFHCHRAVLAACSNYFKAMFTADM      1 - 70
KEKFKNKIKLSGIHHDILEGLVNYAYTSQIEITKRNVQSLLEAADLLQFLSVKKACERFLVRHLDIDNCI     71 - 140
GMHSFAEFHVCPELEKESRRILCSKFKEVWQQEEFLEISLEKFLFILSRKNLSVWKEEAIIEPVIKWTAH    141 - 210
DVENRIECLYNLLSYINIDIDPVYLKTALGLQRSCLLTENKIRSLIYNALNPMHKEISQRSTATMYIIGG    211 - 280
YYWHPLSEVHIWDPLTNVWIQGAEIPDYTRESYGVTCLGPNIYVTGGYRTDNIEALDTVWIYNSESDEWT    281 - 350
EGLPMLNARYYHCAVTLGGCVYALGGYRKGAPAEEAEFYDPLKEKWIPIANMIKGVGNATACVLHDVIYV    351 - 420
IGGHCGYRGSCTYDKVQSYNSDINEWSLITSSPHPEYGLCSVPFENKLYLVGGQTTITECYDPEQNEWRE    421 - 490
IAPMMERRMECGAVIMNGCIYVTGGYSYSKGTYLQSIEKYDPDLNKWEIVGNLPSAMRSHGCVCVYNV      491 - 558
//

Text Mined References (8)

PMID Year Title
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
23676014 2013 Update on the Kelch-like (KLHL) gene family.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
16765319 2006 Downregulation of two novel genes in Sl/Sld and W(LacZ)/Wv mouse jejunum.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.