Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.64
PubTator Score 1.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 6.07419016047493E-12
malignant mesothelioma 3163 7.04781907306501E-8
lung cancer 4473 5.03462793066756E-6
osteosarcoma 7933 1.59014316596494E-5
medulloblastoma 1524 6.83878019157999E-5
medulloblastoma, large-cell 6234 2.5921805245276E-4
nasopharyngeal carcinoma 1056 4.99777279333201E-4
subependymal giant cell astrocytoma 2287 9.64270084714121E-4
gastric carcinoma 832 0.0241796065274683
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0316398113798914
Disease Target Count Z-score Confidence
Alzheimer's disease 644 0.0 1.0
Disease Target Count Z-score Confidence
Cone dystrophy 59 3.77 1.9
cone-rod dystrophy 60 3.517 1.8

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.800 0.000
osteosarcoma 1.603 0.000
medulloblastoma 1.200 0.000
medulloblastoma, large-cell 1.600 0.000
intraductal papillary-mucinous neoplasm ... 1.500 0.032
lung cancer 2.200 0.000
subependymal giant cell astrocytoma -2.059 0.001
nasopharyngeal carcinoma 1.600 0.000
lung carcinoma 1.100 0.000
gastric carcinoma 1.400 0.024

Synonym

Accession Q8NBE8 Q8N9B9 Q96FT8
Symbols DITHP

Gene

  Ortholog (9)

Species Source
Mouse EggNOG Inparanoid
Rat EggNOG Inparanoid
Horse EggNOG Inparanoid
Cow EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken EggNOG Inparanoid
Anole lizard EggNOG Inparanoid
Xenopus EggNOG Inparanoid
Zebrafish EggNOG Inparanoid

AA Sequence

MALKGQEDYIYLFKDSTHPVDFLDAFRTFYLDGLFTDITLQCPSGIIFHCHRAVLAACSNYFKAMFTADM      1 - 70
KEKFKNKIKLSGIHHDILEGLVNYAYTSQIEITKRNVQSLLEAADLLQFLSVKKACERFLVRHLDIDNCI     71 - 140
GMHSFAEFHVCPELEKESRRILCSKFKEVWQQEEFLEISLEKFLFILSRKNLSVWKEEAIIEPVIKWTAH    141 - 210
DVENRIECLYNLLSYINIDIDPVYLKTALGLQRSCLLTENKIRSLIYNALNPMHKEISQRSTATMYIIGG    211 - 280
YYWHPLSEVHIWDPLTNVWIQGAEIPDYTRESYGVTCLGPNIYVTGGYRTDNIEALDTVWIYNSESDEWT    281 - 350
EGLPMLNARYYHCAVTLGGCVYALGGYRKGAPAEEAEFYDPLKEKWIPIANMIKGVGNATACVLHDVIYV    351 - 420
IGGHCGYRGSCTYDKVQSYNSDINEWSLITSSPHPEYGLCSVPFENKLYLVGGQTTITECYDPEQNEWRE    421 - 490
IAPMMERRMECGAVIMNGCIYVTGGYSYSKGTYLQSIEKYDPDLNKWEIVGNLPSAMRSHGCVCVYNV      491 - 558
//

Text Mined References (8)

PMID Year Title
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
23676014 2013 Update on the Kelch-like (KLHL) gene family.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
16765319 2006 Downregulation of two novel genes in Sl/Sld and W(LacZ)/Wv mouse jejunum.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.