Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.46
PubTator Score 1.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
gastric carcinoma 1.400 2.4e-02
group 4 medulloblastoma 1.100 6.1e-03
intraductal papillary-mucinous neoplasm ... 1.500 3.2e-02
lung cancer 2.200 5.0e-06
lung carcinoma 1.100 6.1e-12
malignant mesothelioma 1.800 7.0e-08
medulloblastoma, large-cell 1.600 2.6e-04
nasopharyngeal carcinoma 1.600 5.0e-04
osteosarcoma -1.023 4.6e-02
subependymal giant cell astrocytoma -2.059 9.6e-04

Synonym

Accession Q8NBE8 Q8N9B9 Q96FT8
Symbols DITHP

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MALKGQEDYIYLFKDSTHPVDFLDAFRTFYLDGLFTDITLQCPSGIIFHCHRAVLAACSNYFKAMFTADM      1 - 70
KEKFKNKIKLSGIHHDILEGLVNYAYTSQIEITKRNVQSLLEAADLLQFLSVKKACERFLVRHLDIDNCI     71 - 140
GMHSFAEFHVCPELEKESRRILCSKFKEVWQQEEFLEISLEKFLFILSRKNLSVWKEEAIIEPVIKWTAH    141 - 210
DVENRIECLYNLLSYINIDIDPVYLKTALGLQRSCLLTENKIRSLIYNALNPMHKEISQRSTATMYIIGG    211 - 280
YYWHPLSEVHIWDPLTNVWIQGAEIPDYTRESYGVTCLGPNIYVTGGYRTDNIEALDTVWIYNSESDEWT    281 - 350
EGLPMLNARYYHCAVTLGGCVYALGGYRKGAPAEEAEFYDPLKEKWIPIANMIKGVGNATACVLHDVIYV    351 - 420
IGGHCGYRGSCTYDKVQSYNSDINEWSLITSSPHPEYGLCSVPFENKLYLVGGQTTITECYDPEQNEWRE    421 - 490
IAPMMERRMECGAVIMNGCIYVTGGYSYSKGTYLQSIEKYDPDLNKWEIVGNLPSAMRSHGCVCVYNV      491 - 558
//

Text Mined References (8)

PMID Year Title