Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma -1.500 0.000
medulloblastoma, large-cell -1.500 0.000
atypical teratoid/rhabdoid tumor -1.200 0.000
group 3 medulloblastoma -1.300 0.000
lung carcinoma 1.100 0.000
ovarian cancer 1.100 0.000

AA Sequence

MASAEPLTALSRWYLYAIHGYFCEVMFTAAWEFVVNLNWKFPGVTSVWALFIYGTSILIVERMYLRLRGR      1 - 70
CPLLLRCLIYTLWTYLWEFTTGFILRQFNACPWDYSQFDFDFMGLITLEYAVPWFCGALIMEQFIIRNTL     71 - 140
RLRFDKDAEPGEPSGALALANGHVKTD                                               141 - 167
//

Text Mined References (6)

PMID Year Title
25064009 2014 Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.