Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.9e-24
ovarian cancer 8520 1.5e-09
osteosarcoma 7950 2.3e-07
diabetes mellitus 1728 9.1e-03

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus 1.300 9.1e-03
osteosarcoma 1.385 2.3e-07
ovarian cancer 1.300 1.5e-09
psoriasis -1.700 2.9e-24

AA Sequence

MFPRPVLNSRAQAILLPQPPNMLDHRQWPPRLASFPFTKTGMLSRATSVLAGLTAHLWDLGGGAGRRTSK      1 - 70
AQRVHPQPSHQRQPPPPQHPGPYQERIWVGGEGWGEVGGLRLSKVGRRDREVGRGLRAPAGRGRAMGGMP     71 - 140
RMGTVGDFGQALSSLAWTSTCFQDFCLPSLPGKLPAPLISKQQFLSNSSRSLFN                    141 - 194
//

Text Mined References (12)

PMID Year Title