Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Synonym

Accession Q8NBB2
Symbols C15orf37

Gene

 Compartment GO Term (0)

AA Sequence

MPRPASESWSPIQSRIPAYKAVSHLRLLPTANSPSGSNQPTNPNRAQHPEGPQSREGATSPVLASLEPPT      1 - 70
PTDLPSARARPRVPAESGPGWLHKARRPTRGILRDVLRHRGVPAQPRPAPGAHQLSSPSS               71 - 130
//

Text Mined References (3)

PMID Year Title