Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.46
PubTator Score 0.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 2.1
Disease Target Count Z-score Confidence
primary open angle glaucoma 16 3.067 1.5

Expression

Synonym

Accession Q8NBA8
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MESQKEARTLQEPVARPSGASSSQTPNDKERREGGAVPAAAALGAEADDDSADGLWELPVEPAERRPECT      1 - 70
RCSRPQKVCLCPFLPAHPLHISTHLYIIQHPAEENKVLRTVPLLAACLPQDKCKVKIGRRFSEERDPELS     71 - 140
TVCRKSGTLILYPGAEAANLEEFILDSPVYPSTIIIIDGTWSQAKDIFYKNSLFRHPKQVQLKTSISSQY    141 - 210
VIRMQPTNRCLSTLECAAVALSILEKNNYIQETLLRPLQALCSFQLQHGAQIRLSKEHLLKNGLYPKPMP    211 - 280
KNKRKLRKMELLMNSVKI                                                        281 - 298
//

Text Mined References (11)

PMID Year Title