Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.45
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.300 0.000

Gene RIF (1)

PMID Text
26419067 A high polymorphic ZNF527 allele frequency implies that rs386809049 polymorphism in ZNF527 gene cannot be the major cause of intellectual disability in the Ukrainian population.

AA Sequence

MAVGLCKAMSQGLVTFRDVALDFSQEEWEWLKPSQKDLYRDVMLENYRNLVWLGLSISKPNMISLLEQGK      1 - 70
EPWMVERKMSQGHCADWESWCEIEELSPKWFIDEDEISQEMVMERLASHGLECSSFREAWKYKGEFELHQ     71 - 140
GNAERHFMQVTAVKEISTGKRDNEFSNSGRSIPLKSVFLTQQKVPTIQQVHKFDIYDKLFPQNSVIIEYK    141 - 210
RLHAEKESLIGNECEEFNQSTYLSKDIGIPPGEKPYESHDFSKLLSFHSLFTQHQTTHFGKLPHGYDECG    211 - 280
DAFSCYSFFTQPQRIHSGEKPYACNDCGKAFSHDFFLSEHQRTHIGEKPYECKECNKAFRQSAHLAQHQR    281 - 350
IHTGEKPFACNECGKAFSRYAFLVEHQRIHTGEKPYECKECNKAFRQSAHLNQHQRIHTGEKPYECNQCG    351 - 420
KAFSRRIALTLHQRIHTGEKPFKCSECGKTFGYRSHLNQHQRIHTGEKPYECIKCGKFFRTDSQLNRHHR    421 - 490
IHTGERPFECSKCGKAFSDALVLIHHKRSHAGEKPYECNKCGKAFSCGSYLNQHQRIHTGEKPYECSECG    491 - 560
KAFHQILSLRLHQRIHAGEKPYKCNECGNNFSCVSALRRHQRIHNRETL                         561 - 609
//

Text Mined References (5)

PMID Year Title
26419067 ZNF527 GENE rs386809049 ANALYSIS IN POPULATION OF UKRAINE.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11347906 2001 Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.