Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.114 1.7e-08
pancreatic ductal adenocarcinoma liver m... 1.005 1.6e-02

 GO Component (1)

 Compartment GO Term (2)

AA Sequence

MASERLPNRPACLLVASGAAEGVSAQSFLHCFTMASTAFNLQVATPGGKAMEFVDVTESNARWVQDFRLK      1 - 70
AYASPAKLESIDGARYHALLIPSCPGALTDLASSGSLARILQHFHSESKPICAVGHGVAALCCATNEDRS     71 - 140
WVFDSYSLTGPSVCELVRAPGFARLPLVVEDFVKDSGACFSASEPDAVHVVLDRHLVTGQNASSTVPAVQ    141 - 210
NLLFLCGSRK                                                                211 - 220
//

Text Mined References (6)

PMID Year Title