Property Summary

NCBI Gene PubMed Count 42
PubMed Score 549.83
PubTator Score 46.32

Knowledge Summary

Patent (3,806)

Expression

  Differential Expression (9)

Disease log2 FC p
interstitial cystitis 1.200 2.1e-04
intraductal papillary-mucinous adenoma (... 1.100 9.8e-03
intraductal papillary-mucinous neoplasm ... 1.100 3.1e-02
lung carcinoma -2.000 3.3e-22
non-small cell lung cancer -1.264 2.7e-15
osteosarcoma -2.333 1.9e-05
psoriasis 1.300 1.9e-76
tuberculosis 1.600 2.6e-05
ulcerative colitis 1.700 7.7e-08

Gene RIF (35)

AA Sequence

MENLKHIITLGQVIHKRCEEMKYCKKQCRRLGHRVLGLIKPLEMLQDQGKRSVPSEKLTTAMNRFKAALE      1 - 70
EANGEIEKFSNRSNICRFLTASQDKILFKDVNRKLSDVWKELSLLLQVEQRMPVSPISQGASWAQEDQQD     71 - 140
ADEDRRAFQMLRRDNEKIEASLRRLEINMKEIKETLRQYLPPKCMQEIPQEQIKEIKKEQLSGSPWILLR    141 - 210
ENEVSTLYKGEYHRAPVAIKVFKKLQAGSIAIVRQTFNKEIKTMKKFESPNILRIFGICIDETVTPPQFS    211 - 280
IVMEYCELGTLRELLDREKDLTLGKRMVLVLGAARGLYRLHHSEAPELHGKIRSSNFLVTQGYQVKLAGF    281 - 350
ELRKTQTSMSLGTTREKTDRVKSTAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKI    351 - 420
RKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEILKKLSTFSK                       421 - 471
//

Text Mined References (50)

PMID Year Title