Property Summary

NCBI Gene PubMed Count 27
Grant Count 7
R01 Count 1
Funding $1,530,422.12
PubMed Score 486.08
PubTator Score 46.32

Knowledge Summary

Patent (3,806)

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -2.333 0.000
tuberculosis 1.600 0.000
non-small cell lung cancer -1.264 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.010
intraductal papillary-mucinous neoplasm ... 1.100 0.031
interstitial cystitis 1.300 0.000
lung carcinoma -2.000 0.000
ulcerative colitis 1.700 0.000
psoriasis 1.300 0.000

Synonym

Accession Q8NB16 A6NCE4 Q8N6V0 hMLKL
Symbols hMLKL

Gene

PDB

2MSV   4M67   4MWI  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (20)

PMID Text
26853145 Results show that upon activation, MLKL undergoes oligomerization mediated by the brace domain, being recruited to the plasma membrane through avidity of N-terminal helix bundle for phosphatidylinositol phosphate (PIP).
26823841 MLKL was a prognostic biomarker for cervical squamous cell carcinoma
26704887 Modelling predicts that a C-terminal helix constrains the activity of MLKL1, but not MLKL2
26283547 These data reveal a potential role for RIPK3 as a suppressor of MLKL activation and indicate that phosphorylation can fine-tune the ability of MLKL to induce necroptosis.
26165695 MLKL upregulation in SPARC overexpressed cells treated with Ara-C, indicates necrosis as a possible cell death process for the SKM-1 cells under these stringent conditions
25766324 a novel non-enzymatic function of AChE-R is to stimulate RIPK1/MLKL-dependent regulated necrosis (necroptosis). The latter complements a cholinergic system in the ovary, which determines life and death of ovarian cells.
25748555 High expression of RIP3 in keratinocytes from toxic epidermal necrolysis patients potentiates MLKL phosphorylation/activation and necrotic cell death.
25697054 in the absence of caspase-8 activity, 24(S)-Hydroxycholesterol induces a necroptosis-like cell death which is RIPK1-dependent but MLKL-independent.
25220470 MLKL structure determined by nuclear magnetic resonance spectroscopy reveals how different structural elements of the MLKL N-terminal region contribute to MLKL function and membrane permeation.
24813885 Authors demonstrate that the full four-helical bundle domain (4HBD) in the N-terminal region of MLKL is required and sufficient to induce its oligomerization and trigger cell death.
More...

AA Sequence

MENLKHIITLGQVIHKRCEEMKYCKKQCRRLGHRVLGLIKPLEMLQDQGKRSVPSEKLTTAMNRFKAALE      1 - 70
EANGEIEKFSNRSNICRFLTASQDKILFKDVNRKLSDVWKELSLLLQVEQRMPVSPISQGASWAQEDQQD     71 - 140
ADEDRRAFQMLRRDNEKIEASLRRLEINMKEIKETLRQYLPPKCMQEIPQEQIKEIKKEQLSGSPWILLR    141 - 210
ENEVSTLYKGEYHRAPVAIKVFKKLQAGSIAIVRQTFNKEIKTMKKFESPNILRIFGICIDETVTPPQFS    211 - 280
IVMEYCELGTLRELLDREKDLTLGKRMVLVLGAARGLYRLHHSEAPELHGKIRSSNFLVTQGYQVKLAGF    281 - 350
ELRKTQTSMSLGTTREKTDRVKSTAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKI    351 - 420
RKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEILKKLSTFSK                       421 - 471
//

Text Mined References (35)

PMID Year Title
26853145 2016 Sequential Engagement of Distinct MLKL Phosphatidylinositol-Binding Sites Executes Necroptosis.
26823841 2015 Mixed lineage kinase domain-like protein is a prognostic biomarker for cervical squamous cell cancer.
26704887 2015 Analysis of the N-terminal region of human MLKL, as well as two distinct MLKL isoforms, reveals new insights into necroptotic cell death.
26337687 2015 A tale of two domains - a structural perspective of the pseudokinase, MLKL.
26283547 2015 Necroptosis signalling is tuned by phosphorylation of MLKL residues outside the pseudokinase domain activation loop.
26165695 2015 SPARC ectopic overexpression inhibits growth and promotes programmed cell death in acute myeloid leukemia transformed from myelodysplastic syndrome cells, alone and in combination with Ara-C treatment.
25766324 2015 Readthrough acetylcholinesterase (AChE-R) and regulated necrosis: pharmacological targets for the regulation of ovarian functions?
25748555 2015 Upregulated RIP3 Expression Potentiates MLKL Phosphorylation-Mediated Programmed Necrosis in Toxic Epidermal Necrolysis.
25697054 2015 24(S)-Hydroxycholesterol induces RIPK1-dependent but MLKL-independent cell death in the absence of caspase-8.
25220470 2014 A plug release mechanism for membrane permeation by MLKL.
More...