Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.58
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.7e-05

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.100 1.7e-05

AA Sequence

MQLPPALCARLAAGPGAAEPLPVERDPAAGAAPFRFVARPVRFPREHQFFEDGDVQRHLYLQDVIMQVAD      1 - 70
VPEKPRVPAFACQVAGCCQVFDALDDYEHHYHTLHGNVCSFCKRAFPSGHLLDAHILEWHDSLFQILSER     71 - 140
QDMYQCLVEGCTEKFKTSRDRKDHMVRMHLYPADFRFDKPKKSRSPASAEAPGDSGERSEGEAMEICSEP    141 - 210
VAASPAPAGERRIYRHRSVSELFLKPVLNMCSVLRILGCTWAAALLILNSER                      211 - 262
//

Text Mined References (7)

PMID Year Title