Property Summary

NCBI Gene PubMed Count 147
PubMed Score 446.41
PubTator Score 242.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy -2.313 7.7e-10
adrenocortical carcinoma -2.471 1.3e-08
adult high grade glioma -1.800 9.8e-05
Amyotrophic lateral sclerosis -1.207 1.9e-06
astrocytic glioma -1.300 9.4e-03
Astrocytoma, Pilocytic -1.700 4.5e-08
atypical teratoid / rhabdoid tumor -1.700 4.4e-03
ductal carcinoma in situ -1.100 4.4e-03
ependymoma -1.600 1.8e-02
gastric carcinoma -1.900 2.0e-02
glioblastoma -1.800 2.8e-07
group 4 medulloblastoma 1.200 1.0e-04
invasive ductal carcinoma -1.300 1.0e-02
lung carcinoma 1.400 3.8e-22
oligodendroglioma -1.200 1.8e-02
osteosarcoma 2.099 5.8e-07
pituitary cancer 2.000 3.5e-06
primitive neuroectodermal tumor -1.300 4.7e-02
psoriasis -1.600 7.1e-32
subependymal giant cell astrocytoma -2.427 6.2e-03

 GO Function (1)

Gene RIF (135)

AA Sequence

MHPGSPSAWPPRARAALRLWLGCVCFALVQADSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQ      1 - 70
KKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVT     71 - 140
MKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGLLRS    141 - 210
KI                                                                        211 - 212
//

Text Mined References (150)

PMID Year Title