Property Summary

NCBI Gene PubMed Count 100
Grant Count 16
R01 Count 4
Funding $1,147,359.5
PubMed Score 350.59
PubTator Score 242.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytic glioma -1.300 0.009
ependymoma -2.100 0.000
oligodendroglioma -1.200 0.018
osteosarcoma 2.099 0.000
glioblastoma -1.800 0.000
atypical teratoid/rhabdoid tumor -1.800 0.000
primitive neuroectodermal tumor -1.300 0.047
Amyotrophic Lateral Sclerosis -1.207 0.000
acute quadriplegic myopathy -2.313 0.000
adrenocortical carcinoma -2.471 0.000
pediatric high grade glioma -1.800 0.000
group 4 medulloblastoma 1.200 0.000
pilocytic astrocytoma -1.700 0.000
subependymal giant cell astrocytoma -2.427 0.006
lung carcinoma 1.400 0.000
gastric carcinoma -1.900 0.020
ductal carcinoma in situ -1.100 0.004
invasive ductal carcinoma -1.300 0.010
pituitary cancer 2.000 0.000
psoriasis -1.600 0.000

Gene RIF (88)

PMID Text
26975541 Sprint training for 4weeks significantly decreased the resting serum irisin concentration, despite different training programs
26799325 regulates glucose uptake and promotes lipolysis in adipocytes
26790404 The compositions of skeletal muscle and visceral fat play key roles in the association between circulating irisin and a patient's metabolic phenotype.
26774404 A potential role for FNDC5 acting locally in muscle in a low growth hormone state.
26769830 Crossfit training changes brain-derived neurotrophic factor and irisin levels at rest, after wingate and progressive tests, and improves aerobic capacity and body composition of young physically active men and women
26752184 Serum irisin might exert antagonistic effects on FABP4 in the middle-aged Chinese population.
26698239 Serum irisin levels in polycystic ovary syndrome patients was high compared to controls.
26649318 In patients with diabetes mellitus type 2, irisin correlated positively with insulin sensitivity but is not associated with beta-cell function-related variables.
26625129 Irisin levels in the serum and SF of knee OA patients were negatively correlated with disease severity evaluated by the radiographic KL grading criteria.
26479549 Circulating irisin levels progressively decreased with the worsening of the glucose tolerance. Irisin correlated well with traditional biochemical and anthropometric parameters of metabolic health.
More...

AA Sequence

MHPGSPSAWPPRARAALRLWLGCVCFALVQADSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQ      1 - 70
KKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVT     71 - 140
MKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGLLRS    141 - 210
KI                                                                        211 - 212
//

Text Mined References (103)

PMID Year Title
26975541 2016 Effect of sprint training on resting serum irisin concentration - Sprint training once daily vs. twice every other day.
26799325 2016 Effects and Molecular Mechanism of GST-Irisin on Lipolysis and Autocrine Function in 3T3-L1 Adipocytes.
26790404 2016 The ratio of skeletal muscle mass to visceral fat area is a main determinant linking circulating irisin to metabolic phenotype.
26774404 2016 FNDC5 relates to skeletal muscle IGF-I and mitochondrial function and gene expression in obese men with reduced growth hormone.
26769830 2015 Crossfit training changes brain-derived neurotrophic factor and irisin levels at rest, after wingate and progressive tests, and improves aerobic capacity and body composition of young physically active men and women.
26752184 2016 Circulating Adipocyte Fatty Acid Binding Protein (FABP4) Levels Are Associated with Irisin in the Middle-Aged General Chinese Population.
26698239 2015 Serum irisin levels in patients with polycystic ovary syndrome.
26649318 2016 Circulating Levels of Betatrophin and Irisin Are Not Associated with Pancreatic ?-Cell Function in Previously Diagnosed Type 2 Diabetes Mellitus Patients.
26625129 2016 Association of Irisin and CRP Levels with the Radiographic Severity of Knee Osteoarthritis.
26479549 2016 Irisin in the Glucose Continuum.
More...