Property Summary

NCBI Gene PubMed Count 9
PubMed Score 7.49
PubTator Score 5.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma -1.100 6.9e-09
osteosarcoma -1.149 3.1e-03
pituitary cancer 1.400 3.5e-07
subependymal giant cell astrocytoma -1.183 7.0e-03

Protein-protein Interaction (4)

Gene RIF (3)

AA Sequence

MHLSAVFNALLVSVLAAVLWKHVRLREHAATLEEELALSRQATEPAPALRIDYPKALQILMEGGTHMVCT      1 - 70
GRTHTDRICRFKWLCYSNEAEEFIFFHGNTSVMLPNLGSRRFQPALLDLSTVEDHNTQYFNFVELPAAAL     71 - 140
RFMPKPVFVPDVALIANRFNPDNLMHVFHDDLLPLFYTLRQFPGLAHEARLFFMEGWGEGAHFDLYKLLS    141 - 210
PKQPLLRAQLKTLGRLLCFSHAFVGLSKITTWYQYGFVQPQGPKANILVSGNEIRQFARFMTEKLNVSHT    211 - 280
GVPLGEEYILVFSRTQNRLILNEAELLLALAQEFQMKTVTVSLEDHTFADVVRLVSNASMLVSMHGAQLV    281 - 350
TTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPENTVTHPERPWDQGGITHLDRA    351 - 420
EQARILQSREVPRHLCCRNPEWLFRIYQDTKVDIPSLIQTIRRVVKGRPGPRKQKWTVGLYPGKVREARC    421 - 490
QASVHGASEARLTVSWQIPWNLKYLKVREVKYEVWLQEQGENTYVPYILALQNHTFTENIKPFTTYLVWV    491 - 560
RCIFNKILLGPFADVLVCNT                                                      561 - 580
//

Text Mined References (9)

PMID Year Title