Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

 Compartment GO Term (0)

 GWAS Trait (1)

AA Sequence

MPEPPTPSVGSCAARASRMSAAPCSRAPSPIDHPRAEECGRAARDWQAAPPAAPVRDPLGEASWAPESGE      1 - 70
DMENLYVQLKLQSVGTCFNREELPSVLQWPQGEELGATSVTNKPGLSAMRKETDQQVGERKLTYCGDQVT     71 - 140
LFTDQALSQILSSEEGRIKVM                                                     141 - 161
//

Text Mined References (1)

PMID Year Title