Property Summary

NCBI Gene PubMed Count 33
PubMed Score 14.10
PubTator Score 11.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Rheumatoid arthritis 1.800 8.9e-05
acute myeloid leukemia -1.600 1.1e-02
adult high grade glioma -1.100 7.5e-03
astrocytic glioma 1.400 1.9e-02
atypical teratoid / rhabdoid tumor -1.200 4.9e-04
Breast cancer -1.100 1.7e-14
Chronic Lymphocytic Leukemia 1.822 1.0e-02
Common variable immunodeficiency 1.180 1.1e-02
gastric cancer 1.200 2.7e-03
Gaucher disease type 1 -1.200 3.6e-02
group 3 medulloblastoma -1.200 3.6e-02
intraductal papillary-mucinous adenoma (... 1.200 3.1e-03
medulloblastoma, large-cell -2.800 3.6e-05
oligodendroglioma 1.400 1.4e-02
osteosarcoma 1.910 3.3e-07
ovarian cancer -1.200 2.3e-03
Pick disease 1.700 8.2e-06
primary pancreatic ductal adenocarcinoma 1.108 1.6e-02

Gene RIF (10)

AA Sequence

MTVMSLSRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFKAHSNVLAASSLYFKNIFWSHTICIS      1 - 70
SHVLELDDLKAEVFTEILNYIYSSTVVVKRQETVTDLAAAGKKLGISFLEDLTDRNFSNSPGPYVFCITE     71 - 140
KGVVKEEKNEKRHEEPAITNGPRITNAFSIIETENSNNMFSPLDLRASFKKVSDSMRTASLCLERTDVCH    141 - 210
EAEPVRTLAEHSYAVSSVAEAYRSQPVREHDGSSPGNTGKENCEALAAKPKTCRKPKTFSIPQDSDSATE    211 - 280
NIPPPPVSNLEVNQERSPQPAAVLTRSKSPNNEGDVHFSREDENQSSDVPGPPAAEVPPLVYNCSCCSKA    281 - 350
FDSSTLLSAHMQLHKPTQEPLVCKYCNKQFTTLNRLDRHEQICMRSSHMPIPGGNQRFLENYPTIGQNGG    351 - 420
SFTGPEPLLSENRIGEFSSTGSTLPDTDHMVKFVNGQMLYSCVVCKRSYVTLSSLRRHANVHSWRRTYPC    421 - 490
HYCNKVFALAEYRTRHEIWHTGERRYQCIFCLETFMTYYILKNHQKSFHAIDHRLSISKKTANGGLKPSV    491 - 560
YPYKLYRLLPMKCKRAPYKSYRNSSYENARENSQMNESAPGTYVVQNPHSSELPTLNFQDTVNTLTNSPA    561 - 630
IPLETSACQDIPTSANVQNAEGTKWGEEALKMDLDNNFYSTEVSVSSTENAVSSDLRAGDVPVLSLSNSS    631 - 700
ENAASVISYSGSAPSVIVHSSQFSSVIMHSNAIAAMTSSNHRAFSDPAVSQSLKDDSKPEPDKVGRFASR    701 - 770
PKSIKEKKKTTSHTRGEIPEESNYVADPGGSLSKTTNIAEETSKIETYIAKPALPGTSTNSNVAPLCQIT    771 - 840
VKIGNEAIVKRHILGSKLFYKRGRRPKYQMQEEPLPQGNDPEPSGDSPLGLCQSECMEMSEVFDDASDQD    841 - 910
STDKPWRPYYNYKPKKKSRQLKKMRKVNWRKEHGNRSPSHKCKYPAELDCAVGKAPQDKPFEEEETKEMP    911 - 980
KLQCELCDGDKAVGAGNQGRPHRHLTSRPYACELCAKQFQSPSTLKMHMRCHTGEKPYQCKTCGRCFSVQ    981 - 1050
GNLQKHERIHLGLKEFVCQYCNKAFTLNETLKIHERIHTGEKRYHCQFCFQRFLYLSTKRNHEQRHIREH   1051 - 1120
NGKGYACFQCPKICKTAAALGMHQKKHLFKSPSQQEKIGDVCHENSNPLENQHFIGSEDNDQKDNIQTGV   1121 - 1190
ENVVL                                                                    1191 - 1195
//

Text Mined References (39)

PMID Year Title