Property Summary

NCBI Gene PubMed Count 33
Grant Count 2
Funding $348,075
PubMed Score 12.58
PubTator Score 11.92

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8NAP3 D3DNF6
Symbols CIBZ
ZNF921
PPP1R171

Gene

 Grant Application (2)

Gene RIF (10)

PMID Text
24726359 ZBTB38 regulates replication efficiency by controlling MCM10 transcription.
23302005 The nonsynonymous SNP (rs16851435:T > G,p.Ser319Ala) of ZBTB38 contributed to susceptibility of idiopathic short stature in the Chinese Han population.
21188497 Alternative splicing of human height-related zinc finger and BTB domain-containing 38 gene through Alu exonization
20966902 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20846217 Observational study of gene-disease association. (HuGE Navigator)
20546612 Observational study of gene-disease association. (HuGE Navigator)
20189936 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19266077 Observational study of gene-disease association. (HuGE Navigator)
18391951 There was strongest association with SNPs in the ZBTB38 gene and adult human height.
16354688 ZBTB38 binds methylated methylated CpGs in vitro and in vivo and represses transcrption.

AA Sequence

MTVMSLSRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFKAHSNVLAASSLYFKNIFWSHTICIS      1 - 70
SHVLELDDLKAEVFTEILNYIYSSTVVVKRQETVTDLAAAGKKLGISFLEDLTDRNFSNSPGPYVFCITE     71 - 140
KGVVKEEKNEKRHEEPAITNGPRITNAFSIIETENSNNMFSPLDLRASFKKVSDSMRTASLCLERTDVCH    141 - 210
EAEPVRTLAEHSYAVSSVAEAYRSQPVREHDGSSPGNTGKENCEALAAKPKTCRKPKTFSIPQDSDSATE    211 - 280
NIPPPPVSNLEVNQERSPQPAAVLTRSKSPNNEGDVHFSREDENQSSDVPGPPAAEVPPLVYNCSCCSKA    281 - 350
FDSSTLLSAHMQLHKPTQEPLVCKYCNKQFTTLNRLDRHEQICMRSSHMPIPGGNQRFLENYPTIGQNGG    351 - 420
SFTGPEPLLSENRIGEFSSTGSTLPDTDHMVKFVNGQMLYSCVVCKRSYVTLSSLRRHANVHSWRRTYPC    421 - 490
HYCNKVFALAEYRTRHEIWHTGERRYQCIFCLETFMTYYILKNHQKSFHAIDHRLSISKKTANGGLKPSV    491 - 560
YPYKLYRLLPMKCKRAPYKSYRNSSYENARENSQMNESAPGTYVVQNPHSSELPTLNFQDTVNTLTNSPA    561 - 630
IPLETSACQDIPTSANVQNAEGTKWGEEALKMDLDNNFYSTEVSVSSTENAVSSDLRAGDVPVLSLSNSS    631 - 700
ENAASVISYSGSAPSVIVHSSQFSSVIMHSNAIAAMTSSNHRAFSDPAVSQSLKDDSKPEPDKVGRFASR    701 - 770
PKSIKEKKKTTSHTRGEIPEESNYVADPGGSLSKTTNIAEETSKIETYIAKPALPGTSTNSNVAPLCQIT    771 - 840
VKIGNEAIVKRHILGSKLFYKRGRRPKYQMQEEPLPQGNDPEPSGDSPLGLCQSECMEMSEVFDDASDQD    841 - 910
STDKPWRPYYNYKPKKKSRQLKKMRKVNWRKEHGNRSPSHKCKYPAELDCAVGKAPQDKPFEEEETKEMP    911 - 980
KLQCELCDGDKAVGAGNQGRPHRHLTSRPYACELCAKQFQSPSTLKMHMRCHTGEKPYQCKTCGRCFSVQ    981 - 1050
GNLQKHERIHLGLKEFVCQYCNKAFTLNETLKIHERIHTGEKRYHCQFCFQRFLYLSTKRNHEQRHIREH   1051 - 1120
NGKGYACFQCPKICKTAAALGMHQKKHLFKSPSQQEKIGDVCHENSNPLENQHFIGSEDNDQKDNIQTGV   1121 - 1190
ENVVL                                                                    1191 - 1195
//

Text Mined References (37)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25281659 2015 A novel common variant in DCST2 is associated with length in early life and height in adulthood.
25221879 2014 Genome-wide interrogation of longitudinal FEV1 in children with asthma.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24726359 2014 The RBBP6/ZBTB38/MCM10 axis regulates DNA replication and common fragile site stability.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23302005 2013 An SNP of the ZBTB38 gene is associated with idiopathic short stature in the Chinese Han population.
23251453 2012 Kaiso directs the transcriptional corepressor MTG16 to the Kaiso binding site in target promoters.
More...