Property Summary

NCBI Gene PubMed Count 4
PubMed Score 6.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.300 0.033
ependymoma -1.800 0.021
oligodendroglioma -1.800 0.014
glioblastoma -1.400 0.000
osteosarcoma 3.377 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
group 3 medulloblastoma -1.500 0.030
medulloblastoma, large-cell -2.300 0.000
primitive neuroectodermal tumor -1.400 0.000
adult high grade glioma -1.600 0.001
aldosterone-producing adenoma -1.646 0.003

Synonym

Accession Q8NAN2 Q6MZG0
Symbols FAM73A

Gene

 GO Process (1)

Gene RIF (1)

PMID Text
26711011 Propose that MIGA proteins promote mitochondrial fusion by regulating mitochondrial phospholipid metabolism via MitoPLD.

AA Sequence

MSDCCSAPGISWEAGVGRPAVPGLELQIRRGAMSEETVSESQFSLKTAALRVFDLPLTWYYSLSQIKFSP      1 - 70
VAKKLFVVTAVSAISVIFLAHHFKRKRGKKKGKILPWEPEHLILEYTKRAASDKGSSCSSSRQNLTLSLS     71 - 140
STKDKGSQVCNYANGGLFSKYSGSAQSLASVQSVNSCHSCACGNSNSWDKADEDDIKLVNIPVTTPENLY    141 - 210
LMGMELFEEALRRWEQALTFRNRQAEDEACGSIKLGAGDAIAEENVDDIISTEFIHKLEALLQRAYRLQE    211 - 280
EFEATLGASDPNSLADDIDKDTDITMKGNVEDFGLRDTLSIASTDSFASAAELAEHREVRHTYSLESLCH    281 - 350
CPFYEEAMHLVEEGKIYSRVLRTEMLECLGDSDFLAKLHCIRQAFQVILSESANRIFLAESGRKILSALI    351 - 420
VKARKNPKKFEDVFDEMIYFLEQTDHWGSTEMELAARGVKNLNFYDVVLDFILMDSFEDLENPPTSIQNV    421 - 490
VNNRWLNSSFKETAVASSCWSVLKQKRQQMKIPDGFFAHFYAICEHISPVLAWGFLGPRNSLYDLCCFFK    491 - 560
NQVLLFLKDIFDFEKVRYSSTETLAEDLMQLLIRRTELLMAYLEADALRHTSSCLSSHGHVMSTGLLEAK    561 - 630
VQ                                                                        631 - 632
//

Text Mined References (7)

PMID Year Title
26716412 2016 Mitoguardin-1 and -2 promote maturation and the developmental potential of mouse oocytes by maintaining mitochondrial dynamics and functions.
26711011 2016 Mitoguardin Regulates Mitochondrial Fusion through MitoPLD and Is Required for Neuronal Homeostasis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.