Property Summary

NCBI Gene PubMed Count 4
PubMed Score 6.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.200 2.1e-02
aldosterone-producing adenoma -1.646 2.8e-03
astrocytic glioma -1.300 3.3e-02
atypical teratoid / rhabdoid tumor -1.500 1.8e-04
ependymoma -1.800 2.1e-02
glioblastoma -1.400 1.1e-04
group 3 medulloblastoma -1.500 3.0e-02
medulloblastoma, large-cell -2.300 3.7e-04
oligodendroglioma -1.800 1.4e-02
osteosarcoma 3.377 2.8e-07
primitive neuroectodermal tumor -1.400 1.0e-05

 GO Process (1)

Gene RIF (1)

AA Sequence

MSDCCSAPGISWEAGVGRPAVPGLELQIRRGAMSEETVSESQFSLKTAALRVFDLPLTWYYSLSQIKFSP      1 - 70
VAKKLFVVTAVSAISVIFLAHHFKRKRGKKKGKILPWEPEHLILEYTKRAASDKGSSCSSSRQNLTLSLS     71 - 140
STKDKGSQVCNYANGGLFSKYSGSAQSLASVQSVNSCHSCACGNSNSWDKADEDDIKLVNIPVTTPENLY    141 - 210
LMGMELFEEALRRWEQALTFRNRQAEDEACGSIKLGAGDAIAEENVDDIISTEFIHKLEALLQRAYRLQE    211 - 280
EFEATLGASDPNSLADDIDKDTDITMKGNVEDFGLRDTLSIASTDSFASAAELAEHREVRHTYSLESLCH    281 - 350
CPFYEEAMHLVEEGKIYSRVLRTEMLECLGDSDFLAKLHCIRQAFQVILSESANRIFLAESGRKILSALI    351 - 420
VKARKNPKKFEDVFDEMIYFLEQTDHWGSTEMELAARGVKNLNFYDVVLDFILMDSFEDLENPPTSIQNV    421 - 490
VNNRWLNSSFKETAVASSCWSVLKQKRQQMKIPDGFFAHFYAICEHISPVLAWGFLGPRNSLYDLCCFFK    491 - 560
NQVLLFLKDIFDFEKVRYSSTETLAEDLMQLLIRRTELLMAYLEADALRHTSSCLSSHGHVMSTGLLEAK    561 - 630
VQ                                                                        631 - 632
//

Text Mined References (7)

PMID Year Title