Property Summary

NCBI Gene PubMed Count 10
PubMed Score 28.95
PubTator Score 6.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 5.1e-81
psoriasis 6694 6.0e-19
group 4 medulloblastoma 1855 3.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (3)

Disease log2 FC p
facioscapulohumeral dystrophy 7.900 5.1e-81
group 4 medulloblastoma 1.400 3.5e-02
psoriasis -2.000 6.0e-19

Gene RIF (4)

AA Sequence

MALDLRTIFQCEPSENNLGSENSAFQQSQGPAVQREEGISEFSRMVLNSFQDSNNSYARQELQRLYRIFH      1 - 70
SWLQPEKHSKDEIISLLVLEQFMIGGHCNDKASVKEKWKSSGKNLERFIEDLTDDSINPPALVHVHMQGQ     71 - 140
EALFSEDMPLRDVIVHLTKQVNAQTTREANMGTPSQTSQDTSLETGQGYEDEQDGWNSSSKTTRVNENIT    141 - 210
NQGNQIVSLIIIQEENGPRPEEGGVSSDNPYNSKRAELVTARSQEGSINGITFQGVPMVMGAGCISQPEQ    211 - 280
SSPESALTHQSNEGNSTCEVHQKGSHGVQKSYKCEECPKVFKYLCHLLAHQRRHRNERPFVCPECQKGFF    281 - 350
QISDLRVHQIIHTGKKPFTCSMCKKSFSHKTNLRSHERIHTGEKPYTCPFCKTSYRQSSTYHRHMRTHEK    351 - 420
ITLPSVPSTPEAS                                                             421 - 433
//

Text Mined References (10)

PMID Year Title