Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q8NAJ2
Symbols

Gene

 Compartment GO Term (0)

Protein-protein Interaction (1)

AA Sequence

MAYVALSDKPHLSGEVGEEACSSWNPPLFSPRPLPRLWPLPGTPFLPIRALPFSASSSGKSSLVPSPSSS      1 - 70
AHSGFRTPCLGPDCLLCTQGCELHEGRNHMAVHSCVARAWPGDPQEVRHLNPLLCDPGSQVEPSWPWHPG     71 - 140
LEQAAASWVGNHVSPAHRQALRGHSLGSALRALMPGRHCPLCVPCKRGCDLRGGRGKHGPRPCCPLLRKF    141 - 210
PVLPVHPWPFPCAVWDSGWSCR                                                    211 - 232
//

Text Mined References (2)

PMID Year Title