Property Summary

NCBI Gene PubMed Count 11
Grant Count 4
R01 Count 4
Funding $216,096.2
PubMed Score 17.11
PubTator Score 8.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -4.852 0.000

Synonym

Accession Q8NAG6 A8VU82 Q8N8J8
Symbols LEM3
LEMD6
ANKRD41

Gene

Gene RIF (4)

PMID Text
22399800 Ankle1 is conserved in metazoans and contains a unique C-terminal GIY-YIG motif that confers endonuclease activity in vitro and in vivo
20852633 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20852631 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MCSEARLARRLRDALREEEPWAVEELLRCGADPNLVLEDGAAAVHLAAGARHPRGLRCLGALLRQGGDPN      1 - 70
ARSVEALTPLHVAAAWGCRRGLELLLSQGADPALRDQDGLRPLDLALQQGHLECARVLQDLDTRTRTRTR     71 - 140
IGAETQEPEPAPGTPGLSGPTDETLDSIALQKQPCRGDNRDIGLEADPGPPSLPVPLETVDKHGSSASPP    141 - 210
GHWDYSSDASFVTAVEVSGAEDPASDTPPWAGSLPPTRQGLLHVVHANQRVPRSQGTEAELNARLQALTL    211 - 280
TPPNAAGFQSSPSSMPLLDRSPAHSPPRTPTPGASDCHCLWEHQTSIDSDMATLWLTEDEASSTGGREPV    281 - 350
GPCRHLPVSTVSDLELLKGLRALGENPHPITPFTRQLYHQQLEEAQIAPGPEFSGHSLELAAALRTGCIP    351 - 420
DVQADEDALAQQFEQPDPARRWREGVVKSSFTYLLLDPRETQDLPARAFSLTPAERLQTFIRAIFYVGKG    421 - 490
TRARPYVHLWEALGHHGRSRKQPHQACPKVRQILDIWASGCGVVSLHCFQHVVAVEAYTREACIVEALGI    491 - 560
QTLTNQKQGHCYGVVAGWPPARRRRLGVHLLHRALLVFLAEGERQLHPQDIQARG                   561 - 615
//

Text Mined References (12)

PMID Year Title
27245214 2016 Nucleo-cytoplasmic shuttling of the endonuclease ankyrin repeats and LEM domain-containing protein 1 (Ankle1) is mediated by canonical nuclear export- and nuclear import signals.
24325915 2014 Genome-wide association study identifies 25 known breast cancer susceptibility loci as risk factors for triple-negative breast cancer.
22976474 2012 A meta-analysis of genome-wide association studies of breast cancer identifies two novel susceptibility loci at 6q14 and 20q11.
22399800 2012 The endonuclease Ankle1 requires its LEM and GIY-YIG motifs for DNA cleavage in vivo.
20852633 2010 Common variants at 19p13 are associated with susceptibility to ovarian cancer.
20852631 2010 A locus on 19p13 modifies risk of breast cancer in BRCA1 mutation carriers and is associated with hormone receptor-negative breast cancer in the general population.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15565891 2004 All in the family: evidence for four new LEM-domain proteins Lem2 (NET-25), Lem3, Lem4 and Lem5 in the human genome.
15057824 2004 The DNA sequence and biology of human chromosome 19.
More...