Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.900 0.000

Synonym

Accession Q8NAE3
Symbols C1orf180

Gene

 Compartment GO Term (1)

AA Sequence

MLGPNAQVTVVVAQPGPDHLDHLLLDTQHCQHSSCGSAACTQLTWVPCLGGSHKASIKMSAQAVVSTEAP      1 - 70
WERPCFQAHLGCLQNSVLCSCRMEGFSLFLAMLWGGVGELPSDPRGHLQFLAT                      71 - 123
//

Text Mined References (2)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.