Property Summary

Ligand Count 1
NCBI Gene PubMed Count 21
PubMed Score 27.93
PubTator Score 24.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic 1.500 5.3e-08
atypical teratoid / rhabdoid tumor 1.300 2.5e-03
ependymoma 1.300 4.0e-10
glioblastoma 1.600 2.8e-04
medulloblastoma, large-cell 1.100 3.4e-05
osteosarcoma 1.474 2.6e-05
pediatric high grade glioma 1.400 9.3e-06

Gene RIF (13)

AA Sequence

MPVPWFLLSLALGRSPVVLSLERLVGPQDATHCSPVSLEPWGDEERLRVQFLAQQSLSLAPVTAATARTA      1 - 70
LSGLSGADGRREERGRGKSWVCLSLGGSGNTEPQKKGLSCRLWDSDILCLPGDIVPAPGPVLAPTHLQTE     71 - 140
LVLRCQKETDCDLCLRVAVHLAVHGHWEEPEDEEKFGGAADSGVEEPRNASLQAQVVLSFQAYPTARCVL    141 - 210
LEVQVPAALVQFGQSVGSVVYDCFEAALGSEVRIWSYTQPRYEKELNHTQQLPDCRGLEVWNSIPSCWAL    211 - 280
PWLNVSADGDNVHLVLNVSEEQHFGLSLYWNQVQGPPKPRWHKNLTGPQIITLNHTDLVPCLCIQVWPLE    281 - 350
PDSVRTNICPFREDPRAHQNLWQAARLQLLTLQSWLLDAPCSLPAEAALCWRAPGGDPCQPLVPPLSWEN    351 - 420
VTVDKVLEFPLLKGHPNLCVQVNSSEKLQLQECLWADSLGPLKDDVLLLETRGPQDNRSLCALEPSGCTS    421 - 490
LPSKASTRAARLGEYLLQDLQSGQCLQLWDDDLGALWACPMDKYIHKRWALVWLACLLFAAALSLILLLK    491 - 560
KDHAKGWLRLLKQDVRSGAAARGRAALLLYSADDSGFERLVGALASALCQLPLRVAVDLWSRRELSAQGP    561 - 630
VAWFHAQRRQTLQEGGVVVLLFSPGAVALCSEWLQDGVSGPGAHGPHDAFRASLSCVLPDFLQGRAPGSY    631 - 700
VGACFDRLLHPDAVPALFRTVPVFTLPSQLPDFLGALQQPRAPRSGRLQERAEQVSRALQPALDSYFHPP    701 - 770
GTPAPGRGVGPGAGPGAGDGT                                                     771 - 791
//

Text Mined References (22)

PMID Year Title