Property Summary

NCBI Gene PubMed Count 19
Grant Count 30
R01 Count 18
Funding $2,049,131.79
PubMed Score 24.92
PubTator Score 24.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (11)

PMID Text
25918342 human IL-17RC is essential for mucocutaneous immunity to C. albicans but is otherwise largely redundant.
24885153 results suggested a potential involvement of IL-17RC+CD8+ T cells in pathogenesis of ocular sarcoidosis
22999050 IL-17RC predisposes to the development of adolescent idiopathic scoliosis in a Chinese Han population.
22898922 Data show that IL-17RA, IL-17RC, IL-22R1, ERK1/2 MAPK and NF-kappaB pathways are involved in Th17 cytokine-induced proliferation.
22744455 Overall, our study found a significant association of IL-17RC gene polymorphisms with AIS in a Chinese Han population, indicating IL-17RC gene may be as a susceptibility gene for AIS.
20173024 IL-17 and its receptor IL-17RC are involved in rheumatoid arthritis synovial fluid-mediated chemotaxis in human lung microvascular endothelial cell culture.
18684971 Interleukin-17F is inhibited by the IL-17RC receptor, a combination of soluble IL-17RA/IL-17RC receptors is required for inhibition of the IL-17F/IL-17A activity.
18097068 IL-17A-induced IL-6, IL-8, and CCL20 secretion was dependent on both IL-17RA and IL-17RC, which are overexpressed in RA patients.
17911633 IL-17RC functions as a receptor for both IL-17A and IL-17F; a soluble version of this protein should be an effective antagonist of IL-17A and IL-17F mediated inflammatory diseases.
16785495 The biologic activity of IL-17 is dependent on a complex composed of receptors IL-17RA and IL-17RC.
More...

AA Sequence

MPVPWFLLSLALGRSPVVLSLERLVGPQDATHCSPVSLEPWGDEERLRVQFLAQQSLSLAPVTAATARTA      1 - 70
LSGLSGADGRREERGRGKSWVCLSLGGSGNTEPQKKGLSCRLWDSDILCLPGDIVPAPGPVLAPTHLQTE     71 - 140
LVLRCQKETDCDLCLRVAVHLAVHGHWEEPEDEEKFGGAADSGVEEPRNASLQAQVVLSFQAYPTARCVL    141 - 210
LEVQVPAALVQFGQSVGSVVYDCFEAALGSEVRIWSYTQPRYEKELNHTQQLPDCRGLEVWNSIPSCWAL    211 - 280
PWLNVSADGDNVHLVLNVSEEQHFGLSLYWNQVQGPPKPRWHKNLTGPQIITLNHTDLVPCLCIQVWPLE    281 - 350
PDSVRTNICPFREDPRAHQNLWQAARLQLLTLQSWLLDAPCSLPAEAALCWRAPGGDPCQPLVPPLSWEN    351 - 420
VTVDKVLEFPLLKGHPNLCVQVNSSEKLQLQECLWADSLGPLKDDVLLLETRGPQDNRSLCALEPSGCTS    421 - 490
LPSKASTRAARLGEYLLQDLQSGQCLQLWDDDLGALWACPMDKYIHKRWALVWLACLLFAAALSLILLLK    491 - 560
KDHAKGWLRLLKQDVRSGAAARGRAALLLYSADDSGFERLVGALASALCQLPLRVAVDLWSRRELSAQGP    561 - 630
VAWFHAQRRQTLQEGGVVVLLFSPGAVALCSEWLQDGVSGPGAHGPHDAFRASLSCVLPDFLQGRAPGSY    631 - 700
VGACFDRLLHPDAVPALFRTVPVFTLPSQLPDFLGALQQPRAPRSGRLQERAEQVSRALQPALDSYFHPP    701 - 770
GTPAPGRGVGPGAGPGAGDGT                                                     771 - 791
//

Text Mined References (20)

PMID Year Title
25918342 2015 Inherited IL-17RC deficiency in patients with chronic mucocutaneous candidiasis.
24885153 2014 Overexpression of IL-17RC associated with ocular sarcoidosis.
22999050 2012 A single-nucleotide polymorphism rs708567 in the IL-17RC gene is associated with a susceptibility to and the curve severity of adolescent idiopathic scoliosis in a Chinese Han population: a case-control study.
22898922 2012 Th17-associated cytokines promote human airway smooth muscle cell proliferation.
22744455 2012 Association study of IL-17RC, CHL1, DSCAM and CNTNAP2 genes polymorphisms with adolescent idiopathic scoliosis susceptibility in a Chinese Han population.
20173024 2010 IL-17 contributes to angiogenesis in rheumatoid arthritis.
18684971 2008 The human IL-17F/IL-17A heterodimeric cytokine signals through the IL-17RA/IL-17RC receptor complex.
18097068 2008 IL-17RA and IL-17RC receptors are essential for IL-17A-induced ELR+ CXC chemokine expression in synoviocytes and are overexpressed in rheumatoid blood.
17911633 2007 Identification of the IL-17 receptor related molecule IL-17RC as the receptor for IL-17F.
16785495 2006 Cutting edge: interleukin 17 signals through a heteromeric receptor complex.
More...