Knowledge Summary

Patent

No data available

Synonym

Accession Q8NA96
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MPSSVPKTSIESLGSPSSLSSSQASEPLCPLKHPSHRPPASTLSPNLTSSTESLGYLSSLSSSQPPEPLR      1 - 70
PLECPSHKPCGRSLPRRRNPGWVSWSDSMQADSETDAIICPMCKAPERSCPHTWWVPSSPRVIRGVGRCS     71 - 140
DPNLGLSWRQEAARAWCHCTSSQYPFKHPNLPTHLPKASF                                  141 - 180
//

Text Mined References (2)

PMID Year Title
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.