Property Summary

NCBI Gene PubMed Count 5
Grant Count 4
R01 Count 4
Funding $398,677
PubMed Score 2.11
PubTator Score 3.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Bladder carcinoma 3 3.444 1.7

Expression

Gene RIF (2)

PMID Text
21555518 TEX19 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
18096721 Tex19 is a mammalian-specific protein duplicated in mouse and rat, renamed Tex19.1 and Tex19.2, whereas only one form is found in human.

AA Sequence

MCPPVSMRYEEEGMSYLYASWMYQLQHGDQLSICFTCFKAAFLDFKDLLESEDWEEDNWDPELMEHTEAE      1 - 70
SEQEGSSGMELSWGQSPGQPVQGGSEAWGPGTLAAAPEGLEDAGLDPHFVPTELWPQEAVPLGLGLEDAD     71 - 140
WTQGLPWRFEELLTCSHWPSFFPS                                                  141 - 164
//

Text Mined References (7)

PMID Year Title
23674551 2013 The mammalian-specific Tex19.1 gene plays an essential role in spermatogenesis and placenta-supported development.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
18160741 Molecular profiling of the human testis reveals stringent pathway-specific regulation of RNA expression following gonadotropin suppression and progestogen treatment.
18096721 2008 Tex19, a mammalian-specific protein with a restricted expression in pluripotent stem cells and germ line.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.