Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.63
PubTator Score 0.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession Q8NA75
Symbols WDR21C

Gene

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
23512105 In addition, eight genes classified as 'second tier' hits in the original study (PAX7, THADA, COL8A1/FILIP1L, DCAF4L2, GADD45G, NTN1, RBFOX3 and FOXE1) showed evidence of linkage and association in this replication sample.

AA Sequence

MESKRPRLLEEADKQKKTVRVGLNAPSMLRKNQLGFLRFANYCRIARELRVSCMQRKKVQIHSWDPSSLA      1 - 70
SDRFNRILANTNTDQLFTVNQVEAGGSKYGIITMRGLTTPELRVYPHKTLYVPNRKVNSMCWASLNHLDS     71 - 140
HLLLCFVGLADTPSCAVLLPASLFIGSFPGMRRPGMLCSFQIPDAWSCAWSLSIHAYHSFSTGLSQQVLL    141 - 210
TNVVTGHQQSFGTSSDVLAQQFAIMTPLLFNGCRSGEIFGIDLRCGNQGSGWKAICLSHDSAVTSLQILQ    211 - 280
DGQFLVSSDMTGTIKLWDLRATKCVTQYEGHVNNSAYLPVHVNEEEGVVAAVGQDCYTRIWSLRHGHLLT    281 - 350
TIPSPYPASENDIPSVAFSSRLGGFRGAPGLLMAVREDLYCFSYG                             351 - 395
//

Text Mined References (5)

PMID Year Title
23512105 2013 Confirming genes influencing risk to cleft lip with/without cleft palate in a case-parent trio study.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.