Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.63
PubTator Score 0.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 3.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.4
Kidney cancer 2613 0.0 1.0
Disease Target Count Z-score Confidence
Orofacial cleft 54 0.0 3.0

Gene RIF (1)

AA Sequence

MESKRPRLLEEADKQKKTVRVGLNAPSMLRKNQLGFLRFANYCRIARELRVSCMQRKKVQIHSWDPSSLA      1 - 70
SDRFNRILANTNTDQLFTVNQVEAGGSKYGIITMRGLTTPELRVYPHKTLYVPNRKVNSMCWASLNHLDS     71 - 140
HLLLCFVGLADTPSCAVLLPASLFIGSFPGMRRPGMLCSFQIPDAWSCAWSLSIHAYHSFSTGLSQQVLL    141 - 210
TNVVTGHQQSFGTSSDVLAQQFAIMTPLLFNGCRSGEIFGIDLRCGNQGSGWKAICLSHDSAVTSLQILQ    211 - 280
DGQFLVSSDMTGTIKLWDLRATKCVTQYEGHVNNSAYLPVHVNEEEGVVAAVGQDCYTRIWSLRHGHLLT    281 - 350
TIPSPYPASENDIPSVAFSSRLGGFRGAPGLLMAVREDLYCFSYG                             351 - 395
//

Text Mined References (5)

PMID Year Title